KEGG   Mycobacterium tuberculosis H37Rv: Rv3772Help
Entry
Rv3772            CDS       T00015                                 

Gene name
hisC2
Definition
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv3772 (hisC2)
  Amino acid metabolism
   00340 Histidine metabolism
    Rv3772 (hisC2)
   00350 Tyrosine metabolism
    Rv3772 (hisC2)
   00360 Phenylalanine metabolism
    Rv3772 (hisC2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3772 (hisC2)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Rv3772 (hisC2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Rv3772 (hisC2)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class II
   Rv3772 (hisC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
4217134..4218195
Genome map
AA seq 353 aa AA seqDB search
MTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCV
QLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVA
GAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHIL
IAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALD
KVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccgcctgcgacccgagctggctgggctgccggtttatgtgcccggcaaaacg
gtgccgggcgccatcaagctggccagcaacgaaaccgtgttcggcccgctgcccagcgtc
cgtgccgccatcgaccgggctaccgacacggtcaaccgctaccccgacaacggctgcgtg
cagctcaaggccgcgctggcccggcatcttggcccggacttcgctcccgagcacgtcgcc
gtcggttgcggctcggtcagcctctgccagcaactcgttcaggtcaccgcctcggttggt
gacgaagtggtcttcggctggcgcagctttgagctctatccaccacaggtccgggtcgcc
ggcgctatccccatccaggtgccgttgaccgaccacacgttcgacctctacgccatgctc
gccacggtcaccgaccgcacccggctgatcttcgtgtgcaaccccaacaatccgacctcc
accgtcgtcggtccggacgcgctggcccgcttcgtcgaggcggttccggcgcacatcctg
atcgccatcgacgaggcgtatgtggagtacatccgggacggcatgcggcccgacagctta
ggcctggttcgcgcacacaacaatgtcgttgtgctgcgtacgttttcgaaagcgtacggc
ctggcggggttgcggatcggctacgcgatcggccaccccgacgtcataaccgcgctggac
aaggtctacgtgccatttaccgtgtcgagtatcgggcaggccgcggccatcgcgtccctg
gacgccgccgacgagctgctggcccgtaccgacaccgtggttgccgagcgcgcccgcgtc
agcgccgagttgcgtgctgccgggttcacgctgccgccatcgcaggccaactttgtctgg
cttccgctgggatcccgcacccaagacttcgtggagcaggccgccgatgcacgcatcgtg
gtccgcccgtacggcacggatggcgttcgggtcaccgtcgccgcaccagaggagaacgac
gcgttcctgcggttcgcccgccgctggcggagcgaccaatga

DBGET integrated database retrieval system