KEGG   Mycobacterium tuberculosis H37Rv: Rv3790Help
Entry
Rv3790            CDS       T00015                                 

Gene name
dprE1
Definition
(RefSeq) decaprenylphosphoryl-beta-D-ribose oxidase
  KO
K16653  
decaprenylphospho-beta-D-ribofuranose 2-oxidase [EC:1.1.98.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.98  With other, known, physiological acceptors
    1.1.98.3  decaprenylphospho-beta-D-ribofuranose 2-dehydrogenase
     Rv3790 (dprE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
4235779..4237164
Genome map
AA seq 461 aa AA seqDB search
MLSVGATTTATRLTGWGRTAPSVANVLRTPDAEMIVKAVARVAESGGGRGAIARGLGRSY
GDNAQNGGGLVIDMTPLNTIHSIDADTKLVDIDAGVNLDQLMKAALPFGLWVPVLPGTRQ
VTVGGAIACDIHGKNHHSAGSFGNHVRSMDLLTADGEIRHLTPTGEDAELFWATVGGNGL
TGIIMRATIEMTPTSTAYFIADGDVTASLDETIALHSDGSEARYTYSSAWFDAISAPPKL
GRAAVSRGRLATVEQLPAKLRSEPLKFDAPQLLTLPDVFPNGLANKYTFGPIGELWYRKS
GTYRGKVQNLTQFYHPLDMFGEWNRAYGPAGFLQYQFVIPTEAVDEFKKIIGVIQASGHY
SFLNVFKLFGPRNQAPLSFPIPGWNICVDFPIKDGLGKFVSELDRRVLEFGGRLYTAKDS
RTTAETFHAMYPRVDEWISVRRKVDPLRVFASDMARRLELL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcgtgggagctaccactaccgccacccggctgaccgggtggggccgcacagcg
ccgtcggtggcgaatgtgcttcgcaccccagatgccgagatgatcgtcaaggcggtggct
cgggtcgccgagtcggggggcggccggggtgctatcgcgcgcgggctgggccgctcctat
ggggacaacgcccaaaacggcggtgggttggtgatcgacatgacgccgctgaacactatc
cactccattgacgccgacaccaagctggtcgacatcgacgccggggtcaacctcgaccaa
ctgatgaaagccgccctgccgttcgggctgtgggtcccggtgctgccgggaacccggcag
gtcaccgtcggcggggcgatcgcctgcgatatccacggcaagaaccatcacagcgctggc
agcttcggtaaccacgtgcgcagcatggacctgctgaccgccgacggcgagatccgtcat
ctcactccgaccggcgaggacgccgaactgttctgggccaccgtcgggggcaacggtctc
accggcatcatcatgcgggccaccatcgagatgacgcccacttcgacggcgtacttcatc
gccgacggcgacgtcaccgccagcctcgacgagaccatcgccctgcacagcgacggcagc
gaagcgcgctacacctattccagtgcctggttcgacgcgatcagcgctcccccgaagctg
ggccgcgcggcggtatcgcgtggccgcctggccaccgtcgagcaattgcctgcgaaactg
cggagcgaacctttgaaattcgatgcgccacagctacttacgttgcccgacgtgtttccc
aacgggctggccaacaaatataccttcggcccgatcggcgaactgtggtaccgcaaatcc
ggcacctatcgcggcaaggtccagaacctcacgcagttctaccatccgctggacatgttc
ggcgaatggaaccgcgcctacggcccagcgggcttcctgcaatatcagttcgtgatcccc
acagaggcggttgatgagttcaagaagatcatcggcgttattcaagcctcgggtcactac
tcgtttctcaacgtgttcaagctgttcggcccccgcaaccaggcgccgctcagcttcccc
atcccgggctggaacatctgcgtcgacttccccatcaaggacgggctggggaagttcgtc
agcgaactcgaccgccgggtactggaattcggcggccggctctacaccgccaaagactcc
cgtaccaccgccgaaacctttcatgccatgtatccgcgcgtcgacgaatggatctccgtg
cgccgcaaggtcgatccgctgcgcgtattcgcctccgacatggcccgacgcttggagctg
ctgtag

DBGET integrated database retrieval system