KEGG   Mycobacterium tuberculosis H37Rv: Rv3792Help
Entry
Rv3792            CDS       T00015                                 

Gene name
aftA
Definition
(RefSeq) arabinofuranosyltransferase
  KO
K13686  
galactan 5-O-arabinofuranosyltransferase [EC:2.4.2.46]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.46  galactan 5-O-arabinofuranosyltransferase
     Rv3792 (aftA)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3792 (aftA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
4237932..4239863
Genome map
AA seq 643 aa AA seqDB search
MPSRRKSPQFGHEMGAFTSARAREVLVALGQLAAAVVVAVGVAVVSLLAIARVEWPAFPS
SNQLHALTTVGQVGCLAGLVGIGWLWRHGRFRRLARLGGLVLVSAFTVVTLGMPLGATKL
YLFGISVDQQFRTEYLTRLTDTAALRDMTYIGLPPFYPPGWFWIGGRAAALTGTPAWEMF
KPWAITSMAIAVAVALVLWWRMIRFEYALLVTVATAAVMLAYSSPEPYAAMITVLLPPML
VLTWSGLGARDRQGWAAVVGAGVFLGFAATWYTLLVAYGAFTVVLMALLLAGSRLQSGIK
AAVDPLCRLAVVGAIAAAIGSTTWLPYLLRAARDPVSDTGSAQHYLPADGAALTFPMLQF
SLLGAICLLGTLWLVMRARSSAPAGALAIGVLAVYLWSLLSMLATLARTTLLSFRLQPTL
SVLLVAAGAFGFVEAVQALGKRGRGVIPMAAAIGLAGAIAFSQDIPDVLRPDLTIAYTDT
DGYGQRGDRRPPGSEKYYPAIDAAIRRVTGKRRDRTVVLTADYSFLSYYPYWGFQGLTPH
YANPLAQFDKRATQIDSWSGLSTADEFIAALDKLPWQPPTVFLMRHGAHNSYTLRLAQDV
YPNQPNVRRYTVDLRTALFADPRFVVEDIGPFVLAIRKPQESA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcagacgcaaaagcccccaattcgggcacgaaatgggggcttttacgtctgct
cgcgcccgggaggtgctggtcgctcttggccagctggcagcggcggtggtagtggccgtc
ggtgtcgcggtggtgtccctgctcgccattgcgcgggtggagtggcccgccttcccgtcg
tccaaccagctgcatgcgctgaccaccgtcggccaggtcggctgcctggccgggctggtc
ggcatcggctggttgtggcggcacggtcgattccggcgactggcccggctgggcgggctg
gttttggtatccgcgtttaccgtcgtgacgctgggcatgccgctgggcgccaccaagctg
tatctgttcggcatctctgtcgaccagcagttccgcaccgaatacctcacccggctcacc
gacaccgccgccctgcgcgacatgacctacatcggactgccaccgttttacccaccgggc
tggttctggatcggcggacgcgcggcggcgctgaccgggacgccggcctgggagatgttc
aagccgtgggcgatcacctcgatggccattgcggtggccgtcgcgctggtgctgtggtgg
cggatgatccgcttcgaatacgccttgctggtcaccgtcgccacagcggcggtgatgctg
gcctacagctcgccggagccctacgccgcgatgatcacggtgttgttgccgccgatgctc
gtactgacctggtcgggcctgggcgcgcgcgaccgtcagggctgggccgcggtggtcggt
gccggcgtcttcctgggcttcgcggccacctggtacaccctgttggtcgcctacggcgcg
ttcacggtggtgctgatggcgctgctgctggccgggtcgcggctgcaatccggaatcaag
gcggcggtagacccgctgtgccggcttgccgtcgtcggcgcgatcgcggccgccatcgga
tccaccacctggctgccctacctgctgcgggcggcccgcgacccggtcagcgacaccggc
agcgcccagcactacctacccgcagacggcgccgcactgaccttccccatgctgcagttc
tccctgctgggcgcgatctgtctgctgggcacgctgtggctggtgatgcgcgcgcgatca
tcggcgccagccggcgccctggccatcggcgtgctggccgtctacctgtggtccctgctg
tcgatgctggccacattggcgcgcaccacactgctgtcgtttcgcctgcagccgacgctg
agcgtgctgctggtggcggccggtgcgttcggcttcgtcgaagcggtccaagcccttggc
aaacggggtcgcggtgtcattccgatggccgccgccatcgggttggccggcgcgatcgcg
ttcagccaggacatccccgacgtgttgcggccggacctgaccatcgcctacaccgacacc
gacggctacggccagcgcggcgaccggcgaccgcccggctccgagaagtactacccagcc
atcgatgccgccatccggcgcgtcaccggcaagcgccgcgatcggaccgtcgtgttgacc
gccgactacagcttcctgtcgtactacccctactggggctttcaggggttgacgccgcac
tacgccaacccgctggcacagttcgacaagcgcgccacacagatcgacagctggtcggga
ctctccaccgccgacgagttcatcgccgcgctggacaagctgccctggcagccgccgacc
gtcttcctcatgcgccacggcgcacataacagctacaccctgcggctggcccaggacgtc
taccccaaccagcccaatgttcgccgctacacggtggacctacggaccgccctcttcgcc
gacccgcgtttcgtcgtcgaggacattggcccgttcgtgctggccatccgcaagccgcag
gagagcgcgtga

DBGET integrated database retrieval system