KEGG   Mycobacterium tuberculosis H37Rv: Rv3794Help
Entry
Rv3794            CDS       T00015                                 

Gene name
embA
Definition
(RefSeq) arabinosyltransferase A
  KO
K11385  
arabinosyltransferase A [EC:2.4.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Rv3794 (embA)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3794 (embA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
4243233..4246517
Genome map
AA seq 1094 aa AA seqDB search
MPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITA
PLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDTGKAGLFVRANQDTVVVAFRD
SVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVG
AQPGLSARVDIDTRFITTPGALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRY
RPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVA
VFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSIALGRLAPAAVAIIVATLTAT
LAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVA
ESARIKYKVGPTIAWYQDFLRYYFLTVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGR
VAGLASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLL
AAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAGEVGSMAKAAVFRYPLYTTAK
ANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGED
LKSDPVVSKPGLVNSDASPNKPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVM
GSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPR
VPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIAELPQYRILPDHKQTAASSNL
WQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVIT
VPGWGRPGPIRALP
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
gtgccccacgacggtaatgagcgatctcaccggatcgcacgcctagcagccgtcgtctcg
ggaatcgcgggtctgctgctgtgcggcatcgttccgctgcttccggtgaaccaaaccacc
gcgaccatcttctggccgcagggcagcaccgccgacggcaacatcacccagatcaccgcc
cctctggtatccggggcgccacgcgcgctggacatctcgatcccctgctcggccatcgcc
acgctgcccgccaacggcggcctggtgctgtccacactgccggccggtggcgtggatacc
ggtaaggccgggctgttcgtccgcgccaaccaggacacggtcgtcgtggcgttccgcgac
tcggtggccgcggtggcggcccgctccacgatcgcagcgggaggctgtagcgcgctgcat
atctgggccgataccggcggcgcgggcgctgattttatgggtatacccggcggcgccggg
accctgccgccggagaagaagccacaggttggcggcatcttcaccgacctgaaggtcgga
gcgcagcccgggctgtcggcccgcgtcgacatcgacactcggtttatcacgacgcccggc
gcgctcaagaaggccgtgatgctcctcggcgtgctggcggtcctggtagccatggtgggg
ctggccgcgctggaccggctcagcaggggccgcaccctgcgcgactggctgacccgatat
cgcccgcgggtgcgggtcggattcgccagccggctcgctgacgcagcggtgatcgcgacc
ttgttgctctggcatgtcatcggcgccacctcgtccgatgacggctaccttctgaccgtc
gcccgggtcgccccgaaggccggctatgtagccaactactaccggtatttcggcacgacg
gaggcgccgttcgactggtatacatcggtgcttgcccagctggcggcggtgagcaccgcc
ggcgtctggatgcgcctgcccgccaccctggccggaatcgcctgctggctgatcgtcagc
cgtttcgtgctgcggcggctgggaccgggcccgggcgggctggcgtccaaccgggtcgct
gtgttcaccgctggtgcggtgttcctgtccgcctggctgccgttcaacaacggcctgcgt
cccgagccgctgatcgcgctgggtgtgctggtcacgtgggtgttggtggaacggtcgatc
gcgctcggacggctggccccggccgcggtagccatcatcgtggcgacgcttaccgcgacg
ctggcaccgcaggggttgatcgcgctggccccgctgctgactggtgcgcgcgccatcgcc
cagaggatccggcgccgccgggcgaccgatggactgctggcgccgctggcggtgctggcc
gcggcgttgtcgctgatcaccgtggtggtgtttcgggaccagacgctggccacggtggcc
gaatcggcacgcatcaagtacaaggtcggcccgaccatcgcctggtaccaggacttcctg
cgctactacttccttaccgtggagagcaacgttgaggggtcgatgtcccgccggttcgcg
gtgctggtgttgctgttctgcctgttcggggtgctgttcgtgctgctgcggcgcggccgg
gtggcggggctggccagcggcccggcctggcgactgatcggcactacggcggtcggcctg
ctgctgctcacgttcacgccaaccaagtgggccgtgcagttcggcgcattcgccgggctg
gccggggtgttgggtgcggtcaccgcgttcacctttgcccgcatcggtctacatagtcga
cgcaacctcacgctgtacgtgaccgcgttgctgttcgtgctggcgtgggcaacctcgggc
atcaacgggtggttctacgtcggcaactacggggtgccgtggtatgacatccagcccgtc
atcgccagccacccggtgacgtcgatgtttctgacgctgtcgatcctcaccggattgctg
gcagcctggtatcacttccggatggactacgccgggcacaccgaagtcaaagacaaccgg
cgcaaccgcatcttggcctctacgccactgctggtggtcgcggtgatcatggtcgcaggc
gaagtcggctcgatggccaaggccgcggtgttccgttacccgctttacaccaccgccaag
gccaacctgaccgcgctcagcaccgggctgtccagctgtgcgatggccgacgacgtgctg
gccgagcccgaccccaatgccggcatgctgcaaccggttccgggccaggcgttcggaccg
gacggaccgctgggcggtatcagtcccgtcggcttcaaacccgagggcgtgggcgaggac
ctcaagtccgacccggtggtctccaaacccgggctggtcaactccgatgcgtcgcccaac
aaacccaacgccgccatcaccgactccgcgggcaccgccggagggaagggcccggtcggg
atcaacgggtcgcacgcggcgctgccgttcggattggacccggcacgtaccccggtgatg
ggcagctacggggagaacaacctggccgccacggccacctcggcctggtaccagttaccg
ccccgcagcccggaccggccgctggtggtggtttccgcggccggcgccatctggtcctac
aaggaggacggcgatttcatctacggccagtccctgaaactgcagtggggcgtcaccggc
ccggacggccgcatccagccactggggcaggtatttccgatcgacatcggaccgcaaccc
gcgtggcgcaatctgcggtttccgctggcctgggcgccgccggaggccgacgtggcgcgc
attgtcgcctatgacccgaacctgagccctgagcaatggttcgccttcaccccgccccgg
gttccggtgctggaatctctgcagcggttgatcgggtcagcgacaccggtgttgatggac
atcgcgaccgcagccaacttcccctgccagcgaccgttttccgagcatctcggcattgcc
gagcttccgcagtaccggatcctgccggaccacaagcagacggcggcgtcgtcgaaccta
tggcagtccagctcgaccggcggtccgttcctgttcacccaggcgctgctgcgcacctcg
acgatcgccacgtacctgcgtggggactggtatcgcgactggggatcggtggagcagtac
caccggctggtgccggccgatcaggctccagacgccgttgtcgaggagggcgtgatcact
gtgcccggctggggtcggccaggaccgatcagggcgctgccatga

DBGET integrated database retrieval system