KEGG   Mycobacterium tuberculosis H37Rv: Rv3800cHelp
Entry
Rv3800c           CDS       T00015                                 

Gene name
pks13
Definition
(RefSeq) polyketide synthase
  KO
K12437  
polyketide synthase 13
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv3800c (pks13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4255945..4261146)
Genome map
AA seq 1733 aa AA seqDB search
MADVAESQENAPAERAELTVPEMRQWLRNWVGKAVGKAPDSIDESVPMVELGLSSRDAVA
MAADIEDLTGVTLSVAVAFAHPTIESLATRIIEGEPETDLAGDDAEDWSRTGPAERVDIA
IVGLSTRFPGEMNTPEQTWQALLEGRDGITDLPDGRWSEFLEEPRLAARVAGARTRGGYL
KDIKGFDSEFFAVAKTEADNIDPQQRMALELTWEALEHARIPASSLRGQAVGVYIGSSTN
DYSFLAVSDPTVAHPYAITGTSSSIIANRVSYFYDFHGPSVTIDTACSSSLVAIHQGVQA
LRNGEADVVVAGGVNALITPMVTLGFDEIGAVLAPDGRIKSFSADADGYTRSEGGGMLVL
KRVDDARRDGDAILAVIAGSAVNHDGRSNGLIAPNQDAQADVLRRAYKDAGIDPRTVDYI
EAHGTGTILGDPIEAEALGRVVGRGRPADRPALLGAVKTNVGHLESAAGAASMAKVVLAL
QHDKLPPSINFAGPSPYIDFDAMRLKMITTPTDWPRYGGYALAGVSSFGFGGANAHVVVR
EVLPRDVVEKEPEPEPEPKAAAEPAEAPTLAGHALRFDEFGNIITDSAVAEEPEPELPGV
TEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLES
IGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFG
AQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQ
IALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGE
YIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFAR
KFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWK
KGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQD
EVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPPTRFKRKEHWLPAHFSGDGSTY
MPGTHVALPDGRHVWEYAPRDGNVDLAALVRAAAAHVLPDAQLTAAEQRAVPGDGARLVT
TMTRHPGGASVQVHARIDESFTLVYDALVSRAGSESVLPTAVGAATAIAVADGAPVAPET
PAEDADAETLSDSLTTRYMPSGMTRWSPDSGETIAERLGLIVGSAMGYEPEDLPWEVPLI
ELGLDSLMAVRIKNRVEYDFDLPPIQLTAVRDANLYNVEKLIEYAVEHRDEVQQLHEHQK
TQTAEEIARAQAELLHGKVGKTEPVDSEAGVALPSPQNGEQPNPTGPALNVDVPPRDAAE
RVTFATWAIVTGKSPGGIFNELPRLDDEAAAKIAQRLSERAEGPITAEDVLTSSNIEALA
DKVRTYLEAGQIDGFVRTLRARPEAGGKVPVFVFHPAGGSTVVYEPLLGRLPADTPMYGF
ERVEGSIEERAQQYVPKLIEMQGDGPYVLVGWSLGGVLAYACAIGLRRLGKDVRFVGLID
AVRAGEEIPQTKEEIRKRWDRYAAFAEKTFNVTIPAIPYEQLEELDDEGQVRFVLDAVSQ
SGVQIPAGIIEHQRTSYLDNRAIDTAQIQPYDGHVTLYMADRYHDDAIMFEPRYAVRQPD
GGWGEYVSDLEVVPIGGEHIQAIDEPIIAKVGEHMSRALGQIEADRTSEVGKQ
NT seq 5202 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtagcggaatcccaggagaacgcccccgccgaaagggccgagctaacggtc
cccgagatgcgccagtggctgcgcaactgggtgggtaaggccgtcggaaaggcaccggac
tcgatcgacgaatcggtgcccatggtggagctgggtctgtcgtcgcgcgatgccgtcgcg
atggccgccgacatagaagacctgaccggggtcacgctgtcggtcgcggtggcgttcgcg
catccgaccatcgaatcgctggccacccggatcatcgagggcgagccggagaccgaccta
gcgggcgatgacgccgaagactggtcgcgcaccggcccggccgagcgcgtcgacatcgcg
atcgtgggcttgtccacccgcttcccgggcgagatgaacacccccgagcagacctggcag
gcgctgctggaaggccgcgacgggatcaccgacctgcccgacgggcgctggtcggaattc
ctcgaagagccgcggctggccgcgcgggtcgccggggcccgcacccggggcggctacctg
aaggacatcaagggcttcgattcggagttcttcgcggtggccaagaccgaagccgacaac
atcgacccgcagcagcggatggcgctggagctgacctgggaggcgctcgagcacgcccgc
atcccggcgtcgagcctgcgcggccaggccgtcggtgtgtacatcggcagctccaccaac
gactacagcttcctggcggtgtcggacccgacggtcgcgcacccgtatgcgatcaccggc
accagcagctcgatcatcgccaaccgggtgtcctacttctacgacttccacggaccgtcg
gtcaccattgacaccgcgtgctcgagttcgctggtggccatccaccagggggtgcaggcg
ctgcgcaacggcgaggccgacgtagtggtcgccggcggggtgaacgcgttgatcacaccg
atggtcaccctgggtttcgacgagatcggtgcggtgctggcgcccgacggccggatcaag
tcgttctcagccgacgccgacggctacacccgctccgaaggcggcggcatgctggtgctc
aagcgggtcgacgacgcccgccgcgacggcgacgcgatcctggccgtgatcgccggcagc
gcggtcaaccacgacggccggtccaacggcctgatcgcacccaaccaggacgcgcaggcc
gacgtgctgcgccgggcctacaaggacgccggcatcgatccgcgcaccgtcgactacatc
gaggcgcacggcaccggcaccatcctcggcgacccaatcgaggccgaggcgctgggccgg
gtggtcggtaggggccgtccggccgatcggccggcgctgctgggtgcggtgaaaaccaac
gtcgggcacctggaatcggcggccggcgcggccagcatggccaaggtggtgctggcgctg
cagcacgacaaactgccgccgtcgatcaacttcgccggccccagcccctacatcgacttc
gacgcgatgcggttgaagatgatcaccacgcccaccgactggccgcgatacggcggctac
gcgctggccggggtgtccagcttcggcttcggcggcgccaacgcgcacgtggtggtgcgc
gaggtcctgccgcgtgacgtggtggaaaaggaaccggaacccgagccggaacccaaggcg
gccgccgaacccgccgaggcgcccacgttggcaggccacgcgctgcggttcgacgagttc
ggcaacatcatcaccgactcggcggtcgccgaagagccggagcccgaactgcccggagtc
accgaggaggcgctgcggctcaaggaagccgcgttggaagagcttgcggcccaagaggtt
acggcaccattggtcccgttggcggtgtcggcgtttctgacgtcccgcaagaaggcggcg
gccgccgagttggcggactggatgcaaagcccggaaggccaggcctcctcgctggaatcg
atcggcaggtcgttgtcgcggcgcaaccacggccgttcccgcgcggtggtgttggcccac
gaccacgacgaggccatcaagggcctgcgcgcggtcgccgcgggcaagcaggcgccgaac
gtgttcagcgtcgacgggccggtgaccaccggcccggtctgggtgctcgccggattcggc
gcccagcatcgcaagatgggcaagagcctgtacctgcgcaacgaggtgttcgcggcgtgg
atcgagaaggtcgacgccctggtccaagacgagctgggctactcggtgctggagctgatc
ctggacgacgcgcaggactacggcatcgagaccacccaggtcaccatcttcgcgatccag
atcgcgctgggtgagctgctgcgccatcacggcgccaaaccggccgcggtcatcggccag
tcgctgggtgaggccgcgtcggcctacttcgccggcgggctgtcgctgcgggatgccacc
cgggcgatctgctcgcgctcgcacctgatgggcgagggtgaggcgatgctgttcggcgag
tacatccggttgatggcgctggtggaatactccgccgacgaaatcagagaagtgttctcc
gacttccccgatctggaggtgtgtgtctacgccgcgcccacccagacggtcatcggcggc
ccccccgagcaggtggacgcgatccttgcccgcgccgaggccgagggcaagttcgcccgc
aaattcgcgaccaagggcgccagccacacctcgcagatggacccgctgctgggcgagctc
accgcggagctgcaaggcatcaagccgacgagcccgacgtgtgggatcttctcgacggtg
cacgagggccgctacatcaaacccggcggcgaacccatccacgacgtcgaatactggaag
aaggggctgcggcattccgtctacttcacccacggcatccgcaacgccgtcgacagcggg
cacaccaccttcctggagctggcacccaatccggtggcgctgatgcaggtcgccctgacc
accgccgatgccgggctgcatgacgcccagttgatcccgacgctggcccgcaagcaagac
gaggtctcctcgatggtctcgaccatggcgcagctgtatgtgtacggccacgacctggac
atacgcacgctgtttagccgcgccagtgggccgcaggattacgcgaacattccgccgacc
cggttcaagcgcaaggagcactggctgcccgcgcacttctccggcgacggctcgacgtac
atgccgggcacccatgtcgccctgccggatgggcggcacgtctgggagtacgcgccgcgg
gacggcaatgtggacttggccgcgttggtcagggccgccgccgcccacgtgcttccggac
gcgcaactgaccgccgccgagcagcgcgcggtgcccggcgacggcgcccggctggtgacg
acgatgacccgtcaccccggcggcgcctcggtgcaggtgcacgcccgcatcgacgagtcc
ttcacgctggtctacgacgccctggtgtcccgagcggggtccgaatcggtgttgcccacc
gcggtgggtgcggcgacggcgatcgcggttgcggacggggcgcctgtcgcgccggaaacg
cccgccgaagacgcggacgccgagacgctttcggacagcctgaccacccgttacatgccg
tccggcatgacccgatggtcgcctgattccggtgagaccatcgccgagcggctgggcctg
attgtcgggtctgcgatgggctatgagcccgaggacctgccgtgggaggtgccgctgatc
gagcttggcctggactcgctgatggcggtgcgcatcaaaaaccgcgtcgagtacgacttc
gacctgccaccgatccagctgaccgcggtgcgcgacgccaacctctacaacgtggagaag
ctgatcgaatacgcggtcgagcaccgtgacgaggtgcagcagctgcacgagcaccagaaa
acccagaccgctgaggagatcgcgcgggcccaggccgaattgctgcatggcaaggtgggc
aagaccgagccggtcgactcggaagccggggttgcgctcccgtcgccgcaaaacggcgag
cagccaaacccgacagggcccgcgctcaacgtcgacgtgccgccgcgggacgctgccgag
cgggtcaccttcgccacctgggcgatcgtcaccggcaagtccccgggcggcatcttcaac
gagctgcccaggctggacgacgaggccgcggccaagattgcgcagcggctttccgagcgc
gccgaaggcccgatcaccgccgaggacgtgctgacgtcgtcgaacatcgaggcgctggcc
gacaaggtgcgcacgtatttggaggccgggcagatcgatgggttcgtccgcaccctgcgg
gcgcggcccgaagcaggcgggaaggtgccggtgttcgtgtttcatccggccggcggctcg
acggtggtgtacgagccgctgctgggccggctgccggcggacaccccaatgtatggcttc
gaacgggtcgaggggtcgatcgaagagcgtgcacagcagtacgtgccgaagctgatcgag
atgcagggcgacgggccctatgtcctggtgggttggtcgctgggcggtgtgctggcctac
gcgtgcgcgatcggtttgcggcggctgggcaaggacgtgcggttcgtcgggctgatcgac
gcggtgcgcgccggtgaggagatcccgcagaccaaggaggagatccgcaagcgctgggac
cgctacgccgccttcgccgagaagacgttcaacgtgaccatcccggcgatcccgtacgag
cagctcgaggagctcgacgacgagggccaggtccggttcgtgctggacgccgtcagccag
tccggtgtgcagatcccggccgggatcatcgaacaccaacgcacgtcgtatctggacaac
cgggcgatcgacaccgcccagatccagccgtacgacgggcatgtcaccctctacatggcc
gatcgctaccatgacgacgcgatcatgttcgagccccgctacgccgtgcgccagccggac
ggcgggtggggcgagtacgtttccgacctcgaggtggtgccgatcggtggcgagcacatt
caggccatcgacgagccgatcatcgccaaggtgggcgaacacatgagccgcgcgttgggg
cagatcgaggccgatcgaacaagtgaggtaggcaagcagtga

DBGET integrated database retrieval system