KEGG   Mycobacterium tuberculosis H37Rv: Rv3801cHelp
Entry
Rv3801c           CDS       T00015                                 

Gene name
fadD32
Definition
(RefSeq) long-chain-fatty-acid--AMP ligase FadD32
  KO
K12428  
fatty acid CoA ligase FadD32
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Acyl-CoA synthetase
  Unknown
   Rv3801c (fadD32)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4261153..4263066)
Genome map
AA seq 637 aa AA seqDB search
MFVTGESGMAYHNPFIVNGKIRFPANTNLVRHVEKWAKVRGDKLAYRFLDFSTERDGVAR
DILWSDFSARNRAVGARLQQVTQPGDRVAILCPQNLDYLISFFGALYSGRIAVPLFDPAE
PGHVGRLHAVLDDCAPSTILTTTDSAEGVRKFIRARSAKERPRVIAVDAVPTEVAATWQQ
PEANEETVAYLQYTSGSTRIPSGVQITHLNLPTNVVQVLNALEGQEGDRGVSWLPFFHDM
GLITVLLASVLGHSFTFMTPAAFVRRPGRWIRELARKPGETGGTFSAAPNFAFEHAAVRG
VPRDDEPPLDLSNVKGILNGSEPVSPASMRKFFEAFAPYGLKQTAVKPSYGLAEATLFVS
TTPMDEVPTVIHVDRDELNNQRFVEVAADAPNAVAQVSAGKVGVSEWAVIVDADTASELP
DGQIGEIWLHGNNLGTGYWGKEEESAQTFKNILKSRISESRAEGAPDDALWVRTGDYGTY
FKDHLYIAGRIKDLVIIDGRNHYPQDLECTAQESTKALRVGYAAAFSVPANQLPQTVFDD
SHAGLKFDPEDTSEQLVIVGERAAGTHKLDHQPIVDDIRAAIAVGHGVTVRDVLLVSAGT
IPRTSSGKIGRRACRAAYLDGSLRSGVGSPTVFATSD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgacaggagagagtgggatggcgtaccacaacccgttcatcgtgaatggaaag
atcaggttcccagccaacaccaacctggttcgtcacgtcgaaaagtgggcgaaggttcgt
ggcgacaagctggcctaccggttcctggacttttccaccgaacgagacggtgtcgcgcgc
gacatcttgtggtctgacttcagcgcgcgcaaccgtgcggtgggagcccgcctgcagcaa
gtcacccagccgggtgaccgcgtcgccatcctgtgcccgcagaacctggactacctcatc
tccttcttcggcgccctctactccggccgcattgcggtgccgttgttcgacccggccgag
ccggggcacgtcggtcggttacacgcggtgctcgacgactgtgccccgtcgacgatcctg
accaccaccgactccgccgaaggggtccgcaagttcatccgggcccgatcggccaaggag
cgcccgcgcgtcattgccgtcgacgcggtgcccaccgaagtcgccgccacctggcagcag
cccgaggccaacgaggaaaccgtcgcgtacttgcagtacacgtcgggttccacccgcata
ccgagcggcgtgcagatcacccatctgaacctgcccaccaatgtggtgcaggtgctcaat
gccctggaaggacaggaaggcgaccgcggggtcagctggctcccgttcttccacgacatg
ggtctgatcacggtgctgctggcgtcggtgctaggccacagcttcacctttatgacgccc
gcggcgttcgtgcggcggcccggtcgctggatccgcgagctcgcccgcaagcccggagaa
accggtggcaccttctctgcggcgccgaacttcgcattcgaacacgccgcggtgcgcggt
gtgcctcgagacgacgagccgccgctggacctgagcaacgtcaagggcatcctcaacggc
agcgagccggtgtcgccggcgtcgatgcgcaagttcttcgaagcatttgcgccgtacggt
ttgaagcagaccgccgtcaagccgtcctatgggctagcggaggccacgctgttcgtctcg
accacgccgatggacgaggtgcccaccgtgatccacgtggaccgcgacgagctgaacaac
cagcggttcgttgaggtggccgccgatgcacccaacgccgtcgcccaggtctctgcgggc
aaggtcggggtcagcgaatgggcggtcatcgtcgacgccgacacggccagcgaactgccg
gacggacagatcggtgagatctggctgcacggcaacaacttgggtaccggttattggggc
aaagaagaagagtccgcccagaccttcaagaacatcctcaaatcgcggatcagcgagtcg
cgcgccgagggcgccccagacgacgcgctgtgggtgcgtaccggcgactacggcacctac
ttcaaggaccacctctacatagccggccggatcaaggacctcgtcatcatcgacggccgc
aatcactacccacaggatctcgagtgcacggcgcaggagtcgaccaaggcgttgcgggtt
ggctacgcggcggccttctcggttccggccaaccagcttcctcagacagtgttcgacgac
tcgcacgccgggctgaaattcgaccccgaggacacctccgagcagctggtgatcgtcggc
gaacgggcggccggcacgcataagctcgaccaccagcccatcgtcgatgacatccgggcg
gccatcgccgtcgggcatggggtgaccgtgcgtgacgtcctgctggtgtcggccggcacg
attccgcgaacctccagcggcaagatcggccgccgcgcctgccgtgcggcctacctcgac
ggcagcctgcgcagtggcgtgggttccccgacggtcttcgccacttcggactga

DBGET integrated database retrieval system