KEGG   Mycobacterium tuberculosis H37Rv: Rv3802cHelp
Entry
Rv3802c           CDS       T00015                                 

Gene name
clp6, culp6
Definition
(RefSeq) membrane protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(4263355..4264365)
Genome map
AA seq 336 aa AA seqDB search
MAKNSRRKRHRILAWIAAGAMASVVALVIVAVVIMLRGAESPPSAVPPGVLPPGPTPAHP
HKPRPAFQDASCPDVQMISVPGTWESSPQQNPLNPVQFPKALLLKVTGPIAQQFAPARVQ
TYTVAYTAQFHNPLTTDNQMSYNDSRAEGTRAMVAAMTDMNNRCPLTSYVLIGFSQGAVI
AGDVASDIGNGRGPVDEDLVLGVTLIADGRRQQGVGNQVPPSPRGEGAEITLHEVPVLSG
LGLTMTGPRPGGFGALDGRTNEICAQGDLICAAPAQAFSPANLPTTLNTLAGGAGQPVHA
MYATPEFWNSDGEPATEWTLNWAHQLIENAPHPKHR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaactctcggcgtaagcgccaccgaatccttgcctggatagcggcgggcgcg
atggcgtccgtcgtagcgctggtcatcgtggccgtggtgatcatgctgcgcggcgccgaa
tcgccgcccagcgcggtgccgccaggagttttaccaccggggcccaccccagcacatccg
cacaaaccccgaccggccttccaggatgcgtcctgccccgacgtgcagatgatctcggtt
cccggaacctgggagtcatcgccgcagcagaacccactgaatccggtgcagtttccgaag
gcgttgctgctcaaggtaactgggccgatcgcccagcaattcgcacccgcccgggtgcag
acctacacagttgcctacacggcccaattccacaatccgctgaccacggataatcagatg
tcgtacaacgacagccgggcagagggcacccgcgcgatggtggcagcgatgaccgatatg
aacaacaggtgcccgttgaccagctatgtgctgatcgggttttcgcagggcgcggtgatc
gcgggcgacgtggctagcgatatcggcaacggccggggacccgtggacgaggacctagta
ctaggcgtgacgctgatcgccgacggtcgtcgtcagcagggggtgggtaatcaggtcccg
cctagcccgcgcggcgaaggcgccgagatcaccctgcacgaagtcccagtgttgtccggg
cttggtttgactatgaccggcccgcggccgggcggttttggtgcgctcgacggccggacc
aacgagatctgcgcccagggcgacctgatctgtgcggccccggcacaggcgttcagtccc
gccaacttgccgactacgctgaacaccctggccggcggcgccggccagccggtccatgct
atgtatgcgacacccgaattctggaattccgatggagaaccggcgaccgagtggacgttg
aactgggcgcatcaacttatcgaaaatgcgccccaccccaaacataggtga

DBGET integrated database retrieval system