KEGG   Mycobacterium tuberculosis H37Rv: Rv3804cHelp
Entry
Rv3804c           CDS       T00015                                 

Gene name
fbpA
Definition
(RefSeq) diacylglycerol acyltransferase/mycolyltransferase Ag85A
  KO
K18851  
diacylglycerol O-acyltransferase / trehalose O-mycolyltransferase [EC:2.3.1.20 2.3.1.122]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rv3804c (fbpA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     Rv3804c (fbpA)
    2.3.1.122  trehalose O-mycolyltransferase
     Rv3804c (fbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4265642..4266658)
Genome map
AA seq 338 aa AA seqDB search
MQLVDRVRGAVTGMSRRLVVGAVGAALVSGLVGAVGGTATAGAFSRPGLPVEYLQVPSPS
MGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSS
FYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAI
YHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNV
GKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFP
DSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgttgacagggttcgtggcgccgtcacgggtatgtcgcgtcgactcgtggtc
ggggccgtcggcgcggccctagtgtcgggtctggtcggcgccgtcggtggcacggcgacc
gcgggggcattttcccggccgggcttgccggtggagtacctgcaggtgccgtcgccgtcg
atgggccgtgacatcaaggtccaattccaaagtggtggtgccaactcgcccgccctgtac
ctgctcgacggcctgcgcgcgcaggacgacttcagcggctgggacatcaacaccccggcg
ttcgagtggtacgaccagtcgggcctgtcggtggtcatgccggtgggtggccagtcaagc
ttctactccgactggtaccagcccgcctgcggcaaggccggttgccagacttacaagtgg
gagaccttcctgaccagcgagctgccggggtggctgcaggccaacaggcacgtcaagccc
accggaagcgccgtcgtcggtctttcgatggctgcttcttcggcgctgacgctggcgatc
tatcacccccagcagttcgtctacgcgggagcgatgtcgggcctgttggacccctcccag
gcgatgggtcccaccctgatcggcctggcgatgggtgacgctggcggctacaaggcctcc
gacatgtggggcccgaaggaggacccggcgtggcagcgcaacgacccgctgttgaacgtc
gggaagctgatcgccaacaacacccgcgtctgggtgtactgcggcaacggcaagccgtcg
gatctgggtggcaacaacctgccggccaagttcctcgagggcttcgtgcggaccagcaac
atcaagttccaagacgcctacaacgccggtggcggccacaacggcgtgttcgacttcccg
gacagcggtacgcacagctgggagtactggggcgcgcagctcaacgctatgaagcccgac
ctgcaacgggcactgggtgccacgcccaacaccgggcccgcgccccagggcgcctag

DBGET integrated database retrieval system