KEGG   Mycobacterium tuberculosis H37Rv: Rv3806cHelp
Entry
Rv3806c           CDS       T00015                                 

Gene name
ubiA
Definition
(RefSeq) decaprenyl-phosphate phosphoribosyltransferase
  KO
K14136  
decaprenyl-phosphate phosphoribosyltransferase [EC:2.4.2.45]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.45  decaprenyl-phosphate phosphoribosyltransferase
     Rv3806c (ubiA)
Prenyltransferases [BR:mtu01006]
 Compound prenylation
  DPPR synthase
   Rv3806c (ubiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(4268925..4269833)
Genome map
AA seq 302 aa AA seqDB search
MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFV
VFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWML
TPNLALVMVVYLAMQLAYCFGLKHQAVVEICVVSSAYLIRAIAGGVATKIPLSKWFLLIM
AFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFER
DGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVA
FG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagatgtggtgactcaacctccggcaaacctggtcgccggggtggtcaaggcg
atccgcccgcgccagtgggtgaaaaacgtgctggtgctggccgcgccgctggccgcgttg
ggcggcggtgtccgctacgactacgtcgaggtgctcagcaaggtgtcgatggccttcgtg
gtgttcagcctggccgcctcggcggtgtacctcgtcaacgatgtgcgtgacgtcgaggca
gaccgggagcaccccaccaaaaggttccggccgatcgccgccggcgtggtgcccgagtgg
ctggcgtacaccgtggcggtggtactgggagtgacatcgctggccggtgcctggatgctg
accccgaacctggcgctggtaatggtcgtctacctcgccatgcagttggcgtattgcttt
ggtctcaagcatcaagcggtggtggaaatctgcgtcgtgtcgtcggcgtatttgatccgc
gccatcgccgggggcgtggccaccaaaatcccgctgtccaagtggtttttgctgatcatg
gcattcggttcgctgttcatggtggccggcaagcgctacgccgagctgcatctggccgaa
cgcaccggcgctgcgatccgcaagtcgctggaaagctacaccagcacctatctgcggttc
gtctggacgttgtcggccaccgcggtggtcttgtgctacgggctgtgggctttcgagcgc
gacggctacagcgggtcctggttcgcggtgtcgatgattccgttcaccatcgcgatcctg
cgctacgcggtggacgtcgatggcggcctggccggggagccggaagatatcgcgctgcgt
gaccgggtattgcagctgctggcgctggcgtggatagcaacggttggggccgctgttgcc
ttcggctag

DBGET integrated database retrieval system