KEGG   Mycobacterium tuberculosis H37Rv: Rv3808cHelp
Entry
Rv3808c           CDS       T00015                                 

Gene name
glfT2
Definition
(RefSeq) galactofuranosyl transferase GlfT
  KO
K16650  
galactofuranosylgalactofuranosylrhamnosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,5/1,6-galactofuranosyltransferase [EC:2.4.1.288]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.288  galactofuranosylgalactofuranosylrhamnosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,5/1,6-galactofuranosyltransferase
     Rv3808c (glfT2)
Glycosyltransferases [BR:mtu01003]
 Polysaccharide
  Bacterial polysaccharide
   Rv3808c (glfT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4270366..4272279)
Genome map
AA seq 637 aa AA seqDB search
MSELAASLLSRVILPRPGEPLDVRKLYLEESTTNARRAHAPTRTSLQIGAESEVSFATYF
NAFPASYWRRWTTCKSVVLRVQVTGAGRVDVYRTKATGARIFVEGHDFTGTEDQPAAVET
EVVLQPFEDGGWVWFDITTDTAVTLHSGGWYATSPAPGTANIAVGIPTFNRPADCVNALR
ELTADPLVDQVIGAVIVPDQGERKVRDHPDFPAAAARLGSRLSIHDQPNLGGSGGYSRVM
YEALKNTDCQQILFMDDDIRLEPDSILRVLAMHRFAKAPMLVGGQMLNLQEPSHLHIMGE
VVDRSIFMWTAAPHAEYDHDFAEYPLNDNNSRSKLLHRRIDVDYNGWWTCMIPRQVAEEL
GQPLPLFIKWDDADYGLRAAEHGYPTVTLPGAAIWHMAWSDKDDAIDWQAYFHLRNRLVV
AAMHWDGPKAQVIGLVRSHLKATLKHLACLEYSTVAIQNKAIDDFLAGPEHIFSILESAL
PQVHRIRKSYPDAVVLPAASELPPPLHKNKAMKPPVNPLVIGYRLARGIMHNLTAANPQH
HRRPEFNVPTQDARWFLLCTVDGATVTTADGCGVVYRQRDRAKMFALLWQSLRRQRQLLK
RFEEMRRIYRDALPTLSSKQKWETALLPAANQEPEHG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactcgccgcgagcctgctgtctcgggtcatcctgccgcgcccaggtgaaccc
cttgacgtgcgcaagctgtacctcgaggagtcaacgaccaacgcccggcgcgcgcatgcg
ccaacccggacctcgctacagattggcgcggagtccgaggtgtcgttcgccacctacttc
aacgctttcccggctagctattggcgacgttggacgacgtgcaaatcggtggtgttgcgc
gtgcaggtgaccggcgccgggcgggtagacgtctaccggaccaaggccaccggtgcccgg
atcttcgttgagggccacgacttcaccggcaccgaggatcagccagccgccgtggagacc
gaagtggtgctgcagcctttcgaagacggcgggtgggtctggttcgacatcaccaccgac
accgcggtcaccctgcacagtggtggctggtatgccaccagccccgctccggggacggcc
aacatcgcggtcggcatcccgacgttcaaccgccccgcagactgcgtcaacgcgctgcga
gaactcaccgccgatccgctggtggaccaggtgatcggggcggtgatcgtgcctgatcag
ggtgagcgcaaggtgcgcgaccacccggatttccccgccgcggctgcgagattgggtagt
cggctctccatccacgaccagcccaacctgggcggttccggcggctacagccgggtgatg
tatgaggcactgaaaaacaccgactgtcagcagatcctattcatggacgacgacatccgc
ctcgagccggactcgattctgcgggtgctggccatgcaccggttcgccaaggcgccgatg
ctggtgggtggtcagatgctcaacctgcaggagccgtcgcacctgcacatcatgggcgaa
gtcgtagaccggtcgatattcatgtggaccgccgcgccgcatgccgagtatgaccacgac
ttcgccgaatacccgttgaacgacaacaactcccgtagcaagttgctgcaccggcgtatc
gatgtcgactacaacggctggtggacgtgcatgatcccacgccaggtcgccgaagagcta
ggacagccgctgccgttgttcatcaaatgggacgacgccgattacggcctgcgggccgcc
gagcacgggtatccgaccgtcacgctgcccggtgcggcgatctggcacatggcctggagc
gataaggatgacgccatcgactggcaggcctatttccatctgcgcaaccggctggtggtg
gccgccatgcactgggacggcccaaaggcgcaagtcatcggcctggtccgcagccatctc
aaggcaaccctgaaacaccttgcctgcctggaatattcgacggtggcaatccagaacaag
gccatcgacgactttctcgccggccccgagcacatcttttcgatcctggaatcggcgctg
ccgcaagtgcaccgcatccgcaagagctatccggacgcggtggtgctgccggcggccagt
gagttgccgccgccgttgcacaagaacaaggcaatgaagccgccggtgaacccgttggtc
atcggctaccggctggcccgcgggatcatgcacaacctgaccgccgccaacccccaacac
caccgtcgcccggagttcaacgttccgacccaggatgcgcgctggttcctgctgtgcact
gtcgacggggccaccgtcaccacggccgacggatgcggcgtggtctaccggcagcgcgac
cgggccaagatgttcgcgttgctgtggcagtcgttgcgccgtcagcgccagttgctgaaa
cggttcgaggagatgcgccggatttatcgcgacgcgttgccgacgctgtccagcaagcag
aagtgggagacggcgctgctgccggcggcaaaccaagagcccgagcatggctga

DBGET integrated database retrieval system