KEGG   Mycobacterium tuberculosis H37Rv: Rv3818Help
Entry
Rv3818            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K14952  
UDP-MurNAc hydroxylase
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    Rv3818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
4282449..4283999
Genome map
AA seq 516 aa AA seqDB search
MQVTSVGHAGFLIQTQAGSILCDPWVNPAYFASWFPFPDNSGLDWGALGECDYLYVSHLH
KDHFDAENLRAHVNKDAVVLLPDFPVPDLRNELQKLGFHRFFETTDSVKHRLRGPNGDLD
VMIIALRAPADGPIGDSALVVADGETTAFNMNDARPVDLDVLASEFGHIDVHMLQYSGAI
WYPMVYDMPARAKDAFGAQKRQRQMDRARQYIAQVGATWVVPSAGPPCFLAPELRHLNDD
GSDPANIFPDQMVFLDQMRAHGQDGGLLMIPGSTADFTGTTLNSLRHPLPAEQVEAIFTT
DKAAYIADYADRMAPVLAAQKAGWAAAAGEPLLQPLRTLFEPIMLQSNEICDGIGYPVEL
AIGPETIVLDFPKRAVREPIPDERFRYGFAIAPELVRTVLRDNEPDWVNTIFLSTRFRAW
RVGGYNEYLYTFFKCLTDERIAYADGWFAEAHDDSSSITLNGWEIQRRCPHLKADLSKFG
VVEGNTLTCNLHGWQWRLDDGRCLTARGHQLRSSRP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcacaagcgttggtcacgccggctttctgatccagacccaggccggcagcatc
ctgtgcgacccttgggtcaatccggcctactttgcgtcttggtttccgttccccgacaac
agcgggctggactggggcgctttgggtgagtgcgattatctgtatgtctcgcacctacat
aaggaccacttcgacgcggaaaatctacgagcgcacgtcaacaaggacgccgtcgtgctg
ctgcccgactttccggtacccgacctgcgaaatgagttgcagaagttaggatttcatcgg
ttcttcgaaaccaccgactcggtcaaacaccgcctgaggggacccaacggcgatctcgac
gtgatgatcatcgcactgcgggcccccgccgacggtccgatcggcgactcggcgctagtc
gttgccgacggcgaaacaacggctttcaacatgaacgacgcccgcccggtcgatttggac
gtgctggcatcggagttcggtcacatcgacgtgcatatgctgcagtactcgggcgcgatc
tggtacccgatggtctacgacatgccggcgcgcgcgaaggatgcgttcggcgcccaaaag
cggcaacggcagatggaccgtgctcgccagtacatcgcgcaggtgggagcgacgtgggtg
gtgccgtcggcggggccgccatgctttttagcccccgagctgcgccacctcaacgacgac
ggtagcgatccggccaatatcttccccgaccagatggtgttcctggatcagatgcgggcg
cacggccaggacggcgggctgctgatgatccccggctcgactgcggatttcactggtaca
accctgaattcattgcgccatccactgcccgccgaacaggtcgaggccatctttaccacc
gacaaagccgcatacatcgctgactatgccgaccggatggcgccggtgctcgccgcgcaa
aaggctggctgggccgccgccgccggcgagccactgctgcagccgctgcgcaccctgttc
gagccgatcatgctgcaaagcaacgagatctgcgacggcatcggatacccggtcgagctc
gccatcggtcccgaaaccattgttttggactttccgaaaagagctgtacgagaaccgatt
cccgacgagaggttccgctacgggttcgcgatcgcgccggagctggtgcgcacggtgctg
cgcgacaacgaacccgactgggtcaacaccatcttcttatccacccgatttcgggcatgg
cgggttggtggctacaacgaatacctttacacgttcttcaagtgtctgaccgacgaacgc
atcgcctacgccgacggctggttcgccgaggcccacgatgactcctcatcgatcaccctg
aacggttgggagatccagcgccgctgcccccatctcaaagccgacctatcgaaattcggt
gtggtggaaggcaacacgctcacttgtaacctgcacggctggcagtggcgtctggacgac
ggtcgctgcctcaccgcccggggccatcaactacgcagttcacggccatga

DBGET integrated database retrieval system