KEGG   Mycobacterium tuberculosis H37Rv: Rv3823cHelp
Entry
Rv3823c           CDS       T00015                                 

Gene name
mmpL8
Definition
(RefSeq) integral membrane transport protein MmpL8
  KO
K06994  
putative drug exporter of the RND superfamily
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(4288260..4291529)
Genome map
AA seq 1089 aa AA seqDB search
MCDVLMQPVRTPRPSTNLRSKPLRPTGDGGVFPRLGRLIVRRPWVVIAFWVALAGLLAPT
VPSLDAISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQSVAVVVLSDAKGLGAADERSY
KELVDALRRDTRDVVMLQDFVTTPPLRELMTSKDNQAWILPVGLPGDLGSTQSKQAYARV
ADIVEHQVAGSTLTANLTGPAATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITM
VLPLITIGMSVVVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR
QGADSDQAVKKALTSIGKVIAASAATVAITFLGMVFTQLGILKTVGPMLGISVAVVFFAA
VTLLPALMVLTGRRGWIAPRRDLTRRFWRSSGVHIVRRPKTHLLASALVLVILAGCAGLA
RYNYDDRKTLPASVESSIGYAALDKHFPSNLIIPEYLFIQSSTDLRTPKALADLEQMVQR
VSQVPGVAMVRGITRPAGRSLEQARTSWQAGEVGSKLDEGSKQIAVHTGDIDKLAGGANL
MASKLGDVRAQVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID
ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGTLAKISELARQ
LQATRAVQTLAATVSGLRGALATVIRAMGSLGMSSPGGVRSKINLVNKGVNDLADGSRQL
AEGVQLLVDQVKKMGFGLGEASAFLLAMKDTATTPAMAGFYIPPELLSYATGESVKAETM
PSEYRDLLGGLNVDQLKKVAAAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGA
QPNTALADAKVSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLI
GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLISRLREEAVLG
VRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQGAFVLGTGLLLDTFLVRTVT
VPAIAVLVGQANWWLPSSWRPATWWPLGRRRGRAQRTKRKPLLPKEEEEQSPPDDDDLIG
LWLHDGLRL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacgtcttgatgcagcctgtcagaacaccgagaccctcgacgaacttacgatcg
aaaccgcttaggccaaccggtgacgggggtgtctttccgcggctagggcgccttatcgtc
cgaaggccgtgggtggtgatcgccttctgggtcgcgcttgcgggtctgcttgcgccgacg
gtgccgtccctggacgcgatctcccagcggcatccagtggcgattctgccatcggacgcc
ccggtgttggtctcgacccggcagatgaccgcggcatttcgtgaagccgggttgcagagc
gttgcggtggtggtgctcagcgatgccaaagggctcggcgcggccgatgaacgcagctac
aaagagctggttgacgccctgcgacgcgatactcgagacgtcgtgatgctccaggacttc
gtcaccacaccgcccctgcgggagctcatgaccagcaaagacaatcaggcctggatcctg
ccggtcggccttcccggcgacctgggttcgacccagtccaagcaggcgtacgcccgcgtc
gctgacatcgtcgaacaccaggtcgcaggctcgacactgacggctaacctgaccgggccc
gcggccaccgtcgccgatctgaacctcaccgggcaacgggaccgcagtcgcatcgagttt
gcgatcacgatcctgttgttggtcattttgctgatcatctacgggaatccgatcaccatg
gtgttgccattgataacaattggcatgtccgtggtggttgcacagcgcctcgttgcaata
gccggcttggcgggcctcggtattgctaaccagagcattatttttatgagcgggatgatg
gtcggtgcgggaacggattacgcggtatttctgattagtcgatatcacgactatttacgg
cagggcgcggattcggatcaagccgtcaagaaggcattgacatccatcggtaaggtgatc
gccgcctccgcggctaccgtagcaatcacctttctcgggatggtgtttacccaactggga
attctcaaaacggttggtccgatgttgggaatctcggtagccgtggtcttcttcgcagct
gtcacactgctacccgccctgatggtgctgaccgggcgtcgcggttggatcgcgccgcgc
cgtgacctcacccggcgcttttggcggagttcgggggtgcacatcgtgcgtcggcccaag
actcatctgctcgccagcgcgctggtgctggttattctggccggctgcgcaggactggcc
cggtacaactacgacgatcgcaagacgcttccggcttccgtcgagagttcgatcgggtat
gccgcgttggacaagcatttcccgtctaacctgatcattcccgagtacctgttcatccaa
tcctcgacggatctgcgcacgccgaaggctctcgccgacctagagcagatggtgcagcgg
gtgagccaagtgccgggtgtcgcgatggtcaggggcattacccgacccgctggacggtcg
ctggagcaggcccggacgtcctggcaggctggcgaagtcggcagcaagctggatgagggt
tccaagcagatcgctgtgcacaccggcgacatcgacaaactggccggtggagccaacctg
atggcgagcaaactcggcgacgtacgggcccaagttaaccgggccatatccacggtcggc
ggcctcatcgacgcgctggcgtaccttcaggacctgctcgggggcaacagggttctcggc
gaactggaaggcgcggagaagctgatcggcagcatgcgggcactcggtgacaccattgac
gcggatgcgagctttgtagcgaacaacaccgagtgggcaagcccggtgctgggggcgctg
gatagcagcccgatgtgcactgccgatccggcttgtgccagtgcgcgcaccgaactgcag
cgtttggtcacagcgcgcgacgacggaacgctggcaaagatatctgagttggctcgacag
ctgcaggccacgcgcgcagtgcagaccctggcagccaccgtgtccggattacgcggggcg
ctggccaccgtcatcagggcgatgggttcactggggatgagcagtcctggtggtgtgcga
tccaagatcaacctggtgaacaagggggtcaatgatctcgccgacgggagccggcaactg
gctgagggcgtgcagttgttggtcgaccaggtgaagaagatgggtttcgggttgggcgag
gcctcggcgttcctattggcaatgaaggacaccgcgaccacgccggcgatggcggggttc
tatattcccccggagttgttgtcgtatgccaccggtgagagcgtcaaagccgagacgatg
ccgtcagagtatcgggatctgctaggcgggctgaatgtagaccaactcaaaaaagtcgcg
gcggccttcatttcacccgacggccactcaatacggtatttgatacaaaccgacctgaat
ccattcagcactgctgccatggaccaaattgacgcgatcacggcggccgctcgaggggcg
caaccaaataccgcactggccgatgccaaggtgtctgtcgtcggattgcccgtcgttctc
aaggacacgcgcgactactccgatcacgacctccgattgatcatcgccatgaccgtctgc
atcgttctgctcatattgatcgttttgctgcgtgcgattgtggcaccgctgtatctgatc
ggctcggttatcgtatcgtacctggcggcgctcggtattggcgttatcgtgttccaattt
ttactcggtcaggaaatgcattggagcattccgggattgaccttcgttatattggtcgcg
gtgggcgcagattacaatatgctgcttatttctaggctgcgtgaagaggccgtcttgggg
gtgcgttccggtgtcatccggaccgtggcctcaacaggtggtgtgatcactgcggcgggt
ttgatcatggctgcctcgatgtacggtctggtattcgccagcttgggtagcgtggttcaa
ggtgcgttcgtcctagggaccgggcttttgctggataccttcttggtgcgtaccgttacc
gtgcccgccattgccgtgttggttgggcaggcgaactggtggttgccgtcaagctggcgg
ccggcaacctggtggccccttggccgacgccgtggccgtgcccaacgaaccaaacgtaag
ccgttgttgcccaaggaagaagaagagcaatcaccgcccgacgacgacgatctgatcggt
ctttggttacacgacgggctcaggctttag

DBGET integrated database retrieval system