KEGG   Mycobacterium tuberculosis H37Rv: Rv3825cHelp
Entry
Rv3825c           CDS       T00015                                 

Gene name
pks2
Definition
(RefSeq) phthioceranic/hydroxyphthioceranic acid synthase
  KO
K12431  
polyketide synthase 2
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv3825c (pks2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(4293225..4299605)
Genome map
AA seq 2126 aa AA seqDB search
MGLGSAASGTGADRGAWTLAEPRVTPVAVIGMACRLPGGIDSPELLWKALLRGDDLITEV
PPDRWDCDEFYDPQPGVPGRTVCKWGGFLDNPADFDCEFFGIGEREAIAIDPQQRLLLET
SWEAMEHAGLTQQTLAGSATGVFAGVTHGDYTMVAADAKQLEEPYGYLGNSFSMASGRVA
YAMRLHGPAITVDTACSSGLTAVHMACRSLHEGESDVALAGGVALMLEPRKAAAGSALGM
LSPTGRCRAFDVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGHTVNIA
TPSQPAQVAAYRAALAAGGVDAATVGMVEAHGPGTPIGDPIEYASVSEVYGVDGPCALAS
VKTNFGHTQSTAGVLGLIKVVLALKHGVVPRNLHFTRLPDEIAGITTNLFVPEVTTPWPT
NGRQVPRRAAVSSYGFSGTNVHAVVEQAPQTEAQPHAASTPPTGTPALFTLSASSADALR
QTAQRLTDWIQQHADSLVLSDLAYTLARRRTHRSVRTAVIASSVDELIAGLGEVADGDTV
YQPAVGQDDRGPVWLFSGQGSQWAAMGADLLTNESVFAATVAELEPLIAAESGFSVTEAM
TAPETVTGIDRVQPTIFAMQVALAATMAAYGVRPGAVIGHSMGESAAAVVAGVLSAEDGV
RVICRRSKLMATIAGSAAMASVELPALAVQSELTALGIDDVVVAVVTAPQSTVIAGGTES
VRKLVDIWERRDVLARAVAVDVASHSPQVDPILDELIAALADLNPKAPEIPYYSATLFDP
REAPACDARYWADNLRHTVRFSAAVRSALDDGYRVFAELSPHPLLTHAVDQIAGSVGMPV
AALAGMRREQPLPLGLRRLLTDLHNAGAAVDFSVLCPQGRLVDAPLPAWSHRFLFYDREG
VDNRSPGGSTVAVHPLLGAHVRLPEEPERHAWQADVGTATLPWLGDHRIHNVAALPGAAY
CEMALSAARAVLGEQSEVRDMRFEAMLLLDDQTPVSTVATVTSPGVVDFAVEALQEGVGH
HLRRASAVLQQVSGECEPPAYDMASLLEAHPCRVDGEDLRRQFDKHGVQYGPAFTGLAVA
YVAEDATATMLAEVALPGSIRSQQGLYAIHPALLDACFQSVGAHPDSQSVGSGLLVPLGV
RRVRAYAPVRTARYCYTRVTKVELVGVEADIDVLDAHGTVLLAVCGLRIGTGVSERDKHN
RVLNERLLTIEWHQRELPEMDPSGAGKWLLISDCAASDVTATRLADAFREHSAACTTMRW
PLHDDQLAAADQLRDQVGSDEFSGVVVLTGSNTGTPHQGSADRGAEYVRRLVGIARELSD
LPGAVPRMYVVTRGAQRVLADDCVNLEQGGLRGLLRTIGAEHPHLRATQIDVDEQTGVEQ
LARQLLATSEEDETAWRDNEWYVARLCPTPLRPQERRTIVADHQQSGMRLQIRTPGDMQT
IELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFAGVVTAVGP
GVTDHKVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDAQAAAVTTAHATAWYGLHEL
ARIRAGDTVLIHSGTGGVGQAAIAIARAAGAEIFATAGTPQRRELLRNMGIEHVYDSRSI
EFAEQIRRDTNGRGVDVVLNSVTGAAQLAGLKLLAFRGRFVEIGKRDIYGDTKLGLFPFR
RNLSFYAVDLGLLSATHPEELRDLLGTVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNA
EHTGKLVLHIPQTGKSLVTLPPEQAQVFRPDGSYIITGGLGGLGLFLAEKMAAAGCGRIV
LNSRTQPTQKMRETIEAIAAMGSEVVVECGDIAQPGTAERLVATAVATGLPVRGVLHAAA
VVEDATLANITDELLARDWAPKVHGAWELHEATSGQPLDWFCLFSSAAALTGSPGQSAYS
AANSWLDAFAHWRQAQGLPATAIAWGAWSDIGQLGWWSASPARASALEESNYTAITPDEG
AYAFEALLRHNRVYTGYAPVIGAPWLVAFAERSRFFEVFSSSNGSGTSKFRVELNELPRD
EWPARLRQLVAEQVSLILRRTVDPDRPLPEYGLDSLGALELRTRIETETGIRLAPKNVSA
TVRGLADHLYEQLAPDDAPAAALSSQ
NT seq 6381 nt NT seq  +upstreamnt  +downstreamnt
ttgggcttggggtcggcggcgtcaggcactggtgcagataggggtgcatggacgttggct
gaaccacgtgtgactccggttgctgttatcggcatggcttgccggctgcccggcgggatc
gattcccccgagttgttgtggaaggcgttgttacgaggcgacgacctgatcaccgaggtg
ccgccggaccggtgggattgcgacgagttctacgacccgcagccgggcgtgcccggtcgg
acggtgtgcaagtggggcggtttcctggataaccccgcggatttcgattgcgagttcttt
ggcatcggcgagcgggaggcgattgcgatcgatccgcagcaacgtctgttgctggagacg
tcctgggaggccatggagcacgccggtcttactcagcaaacgctggcaggctcggcgacc
ggcgtgttcgcgggtgtcacccatggtgactacacgatggtggcggccgacgccaaacaa
ttggaggagccgtacggatatctgggcaacagcttcagcatggcgtcgggccgggtcgcc
tacgcgatgcgactgcacggtccggcaataaccgttgataccgcatgctcgtccggcctg
acggccgtgcacatggcgtgtcgcagcctgcacgagggtgaaagcgacgttgccttggcg
gggggtgtcgccttgatgctggagccacgcaaggccgctgctggatccgctttgggcatg
ttgtccccgaccggacgttgtcgcgcgttcgatgtcgcggctgacgggttcgtgtcaggc
gagggttgtgccgtggtggtgctcaagcggttgccggatgcattggccgacggtgaccgg
atcctggcggtaattcgtggcacgtccgcaaatcaggatggccacacggtcaatatcgcg
acgccttcgcagcccgcacaggttgcggcttatcgagcggcgttggctgccggtggcgtg
gacgccgcgacggtcggcatggtcgaagcgcacggccccggcaccccgatcggtgacccc
attgaatatgcaagtgtctccgaggtgtatggggtcgacggcccgtgcgcactcgcatcg
gtgaagaccaacttcggacacacccagtcgaccgccggggtgctagggctaatcaaggtg
gttctcgctctgaaacatggtgtggttccacgtaatctgcacttcactcggctgcccgat
gagattgctggcatcaccaccaacctcttcgtgcccgaggtgaccacaccgtggcccacc
aacggtcgtcaggtgccccggcgggcggcagtgtcgtcttatgggttctcgggaacgaac
gtgcacgctgttgtggagcaagctccgcaaaccgaagcccagccccacgcggcgagcacc
cccccgaccggcacccctgccttgttcacgctgtccgcttcctcggccgacgcgctgcgg
cagactgctcagcggttgaccgactggatacagcagcacgccgactccctggtgctctcg
gatcttgcgtacacgctggcgcggcggcgtacgcaccggtcggtgcgcacggcggtcatc
gcgagcagcgtcgacgagctgattgccggcttgggcgaggtcgccgacggtgacaccgtt
taccagcccgcggtggggcaggatgaccgcgggccggtctggttattctccgggcaaggg
tcgcagtgggcagcgatgggcgccgatctgctgacgaacgaatcggtgttcgccgcgacc
gttgcggagctagagccattgatcgccgcggagtccgggttctcggtcaccgaggcgatg
acggcgcccgagaccgtgactggcatcgacagagttcagccgaccatcttcgcgatgcag
gtcgcgttggcagccacgatggcggcatacggagtgcgcccgggcgccgtgatcggccac
tcaatgggtgagtcggccgcggctgtggtcgcaggagtgctgtcagccgaagatggggta
cgcgtcatctgccgacgatcaaaactgatggcgacgatcgccggttccgcggcgatggcg
tcggtggagttgcctgccttagctgtgcagtcggaattgaccgctctaggcatcgacgat
gtggtggtcgccgtggtgaccgcgccgcagtccaccgtgatcgccggaggcaccgagtcg
gtgcgcaagctggtcgacatatgggagcggcgagacgtgctggcgcgggcggtggccgtc
gacgtggcttcgcattcgccgcaggtggatccgatcctcgacgagttgatagctgcgctg
gccgacctgaatccgaaagctcctgagattccctactattcggcgacgcttttcgacccg
cgcgaagcgccggcgtgcgacgcgcgttactgggccgacaatttgcgccacaccgtgcgg
ttctccgctgcggtgcgctcggcgctcgacgacgggtaccgagtcttcgccgagctttcg
ccgcacccgctgctgacccacgcggtcgatcagattgccggcagtgtaggcatgccggtt
gccgcgctggccggtatgcggcgggagcagccattgccgctggggctccgtcgcctgctg
acggatctgcacaacgctggtgcggcagtggacttctcggtgctctgtccccaaggccgc
ttggtcgatgctccgctgccggcgtggtcgcaccggttcctgttctatgaccgcgaaggc
gttgacaatcggtcgccgggtggctccacggtagccgtgcacccgttgttgggcgcacac
gtgcgattgcccgaagagccggaacgccacgcctggcaggccgatgttggtaccgcaacc
ttgccctggttgggcgatcaccggatacacaacgtggctgctcttccaggggccgcctac
tgcgagatggcgttgtctgcggcccgtgccgtcctcggcgagcagtccgaagtacgcgac
atgcgctttgaggcgatgctgctgctggatgaccagaccccggtgtccaccgtggcaacg
gtgacctcgcccggtgtcgtcgacttcgccgtcgaggccttgcaggaaggcgttgggcat
cacttgcggcgtgcgtcggcggtgctgcagcaggtatccggcgaatgcgagccgccggcg
tacgacatggcctccttattggaagcccacccttgccgcgtggacggtgaggatctgcgc
cggcaattcgacaagcacggtgtgcaatatggtccggccttcaccggcctggccgtggcc
tatgtcgcggaggatgcgaccgccacaatgctggccgaagtcgcgctgcccggctcgatt
cgttcgcagcagggcctgtacgcaatccacccggccctcctggatgcctgtttccagtcg
gtcggcgcgcatcccgatagccagtcggtaggtagcggcctattggtgccgttgggggtg
cgccgagtccgtgcctatgctccggtgcgtaccgctcgctattgctacacgcgggtgacc
aaagtcgagttggtcggcgtcgaggccgatatcgacgtgctggacgcgcacggcacggtg
ttgctggccgtgtgcggactgcgaatcggtacgggagtgtccgagcgcgacaaacacaat
cgggtgctgaatgagcgcttactcaccatcgaatggcaccagcgtgagctgcccgagatg
gacccctctggcgctggaaaatggctgctgatcagtgactgcgctgcctctgatgtgacc
gctacccggctagcggacgcgtttagggaacacagcgcggcgtgcacgacgatgcggtgg
ccactgcacgacgaccagttggccgccgccgaccagctacgcgatcaagttggtagcgac
gagtttagcggcgtggtcgtgctcaccgggtcgaacaccggtacgccgcatcaggggagc
gcggatcgcggcgctgagtacgttcgccggctggtgggtatcgctcgcgaattgtcagac
cttcccggggcggtgccgcgcatgtacgtcgtgacgcggggtgcccagcgggtgctggcc
gacgactgcgtcaatcttgagcagggcgggctgcgtggtctactgcggacgatcggcgcc
gagcaccctcacctgcgtgccacccagatcgacgtggacgaacagaccggtgtcgagcag
ctggcacgccaattgctggccacgtcggaagaagacgagaccgcctggcgagacaacgag
tggtacgtggcgcgcttgtgtccgaccccgttgcgtcctcaggagcggcgcaccatcgtc
gcggatcatcagcagagcggcatgcgcctgcagatccgtacccccggcgatatgcaaacg
atagagctggccgcgtttcaccgcgttccaccaggaccaggacagatcgaggttgcggtc
cgtgcgtccagcgtcaactttgccgatgtactcatcgctttcggtcgctaccccagcttc
gagggacacctgccccagctgggcacggatttcgccggcgtggtgaccgcggtcggacca
ggcgtcactgaccacaaggttggtgaccatgttggtggcatgtcgcctaacggctgctgg
ggcacattcgtcacgtgtgacgctcggctggccgcgacgctgccaccgggcctgggtgac
gcacaggccgctgcggtgaccaccgcgcacgccaccgcctggtacggactgcatgagctc
gcccggattagggcgggtgacacggtgctaattcactccggcaccggcggggtcggacaa
gcggcgatcgctatagcccgcgcggcgggcgctgagatcttcgccaccgccggtacccca
cagcgtcgagagctattgcgcaacatgggtattgagcatgtctatgactcgcgcagcatc
gagttcgccgagcagattcggcgggacactaacggccggggtgtcgatgtcgtgctcaac
tcggtgaccggcgccgcgcaacttgccgggctgaaactgctcgccttccggggacggttc
gtcgagattggcaagcgcgacatctatggtgacaccaagctggggctctttcccttccgg
cgcaacctgtccttctacgccgtagacctggggttgctgtctgcgacacacccagaagag
ctgcgcgacctgctcggcacggtctatcgcttgaccgcagccggcgagttgccgatgccg
cagagcacccattaccccctcgtcgaggcggccaccgccatccgtgtgatgggcaacgcc
gagcacaccggcaaactcgtcctccacatcccacagaccggaaaaagcctcgttaccctg
cctccggaacaagctcaggtgttccgtcccgacggctcctacatcatcaccggcggcctc
ggtgggctagggctgttcctggccgagaagatggccgcggccggttgcggccggatcgtg
ctgaattcccgcacccagccgacgcaaaagatgagggaaacgatcgaggccatcgcggcg
atgggctctgaagtcgtggtggaatgcggtgacatcgcccaaccgggtaccgcggagcgg
ttggtggcgaccgctgtggccaccgggcttccggtacgaggcgtgctacacgcggccgcg
gtggtcgaggacgccaccttggccaatatcaccgacgagttgctggcgcgcgactgggcg
ccaaaggttcacggtgcctgggagttgcatgaagcaaccagcggacagccgcttgactgg
ttctgcttgttttcgtcggcggcagctctcaccggctcgccgggacagagtgcctactca
gcggccaacagctggctggacgccttcgcgcattggcggcaagctcagggcctgccggct
accgcgatcgcgtggggagcctggtcggatatcggccagttggggtggtggtcggcatcg
cccgcgcgggcttcggcattggaggaaagcaactacacggcgatcactcccgacgaaggt
gcttacgcgttcgaggcgctattgcgccacaaccgcgtctataccggctatgccccggtc
atcggagccccgtggctggtcgccttcgcagagcgcagccggtttttcgaagtgttctcc
agcagcaacggttcgggcacaagcaaattccgcgtcgagctgaacgagctgccacgcgac
gagtggccggcgcggcttcggcagctggtcgccgagcaggtcagcctgattctgcggcgc
accgtcgaccctgaccgcccgctacccgagtatggacttgattcgttgggcgcactagag
ctgcgcactcggatcgagaccgagaccggaatccggttggcacccaagaacgtcagcgcc
acggtgcggggcttagcggatcacttgtatgaacagctggcgcccgacgacgctcctgct
gccgcgctgtcgtcacagtaa

DBGET integrated database retrieval system