KEGG   Mycobacterium tuberculosis H37Rv: Rv3838cHelp
Entry
Rv3838c           CDS       T00015                                 

Gene name
pheA
Definition
(RefSeq) prephenate dehydratase
  KO
K04518  
prephenate dehydratase [EC:4.2.1.51]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv3838c (pheA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv3838c (pheA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Rv3838c (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(4311704..4312669)
Genome map
AA seq 321 aa AA seqDB search
MVRIAYLGPEGTFTEAALVRMVAAGLVPETGPDALQRMPVESAPAALAAVRDGGADYACV
PIENSIDGSVLPTLDSLAIGVRLQVFAETTLDVTFSIVVKPGRNAADVRTLAAFPVAAAQ
VRQWLAAHLPAADLRPAYSNADAARQVADGLVDAAVTSPLAAARWGLAALADGVVDESNA
RTRFVLVGRPGPPPARTGADRTSAVLRIDNQPGALVAALAEFGIRGIDLTRIESRPTRTE
LGTYLFFVDCVGHIDDEAVAEALKAVHRRCADVRYLGSWPTGPAAGAQPPLVDEASRWLA
RLRAGKPEQTLVRPDDQGAQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgtatcgcttacctcggtccggaagggacattcaccgaggcagccctggtccgg
atggtggccgccggcctagttcccgagaccgggcccgatgcactgcagcggatgccggtc
gagagcgcgcccgcagcactggctgcggtccgcgacggcggtgcggattatgcgtgcgtg
ccgatcgagaactcgatcgacggttccgtgctgcctactttggatagcctggccatcggt
gtgcgcctgcaggtgttcgccgagacaacgctggacgtgacgttcagcatcgtggtcaaa
cccgggcgcaacgccgcggacgtgcggaccctggcggcctttccggtggcggctgcacag
gtgcggcagtggttggcggcccatcttcccgccgccgacctgcggccggcttattccaac
gcggacgcggcccggcaggtggctgacggcttggttgacgccgcggtgacctcgccgctg
gcggccgctcgttggggattggcggccctggccgacggtgtcgttgacgaatccaatgcc
cgcacccgcttcgtcctggttggtcggcccgggccgcctccggcgcgcaccggagccgat
cgcacgtctgcagtgctgcgcatcgacaaccagcccggtgcgctggtagctgcgctggcc
gagttcggcatccgcggcatcgatctcactcggattgaatcccggcccacccgtaccgaa
cttggcacctatctgttcttcgtggattgcgtcggccacatcgacgacgaggccgtcgcc
gaggcactcaaggcggtgcaccgacgttgtgctgatgtgcgatacctggggtcctggccg
acggggccagcggcaggggcgcagccgcccctggtagacgaagcatcacgctggttagcg
cggctccgcgcgggcaaacccgagcagaccctggttcgcccggacgaccagggggcgcaa
gcatga

DBGET integrated database retrieval system