KEGG   Mycobacterium tuberculosis H37Rv: Rv3859cHelp
Entry
Rv3859c           CDS       T00015                                 

Gene name
gltB
Definition
(RefSeq) glutamate synthase large subunit
  KO
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv3859c (gltB)
  Energy metabolism
   00910 Nitrogen metabolism
    Rv3859c (gltB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv3859c (gltB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Rv3859c (gltB)
    1.4.1.14  glutamate synthase (NADH)
     Rv3859c (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(4331498..4336081)
Genome map
AA seq 1527 aa AA seqDB search
MTPKRVGLYNPAFEHDSCGVAMVVDMHGRRSRDIVDKAITALLNLEHRGAQGAEPRSGDG
AGILIQVPDEFLREAVDFELPAPGSYATGIAFLPQSSKDAAAACAAVQKIAEAEGLQVLG
WRSVPTDDSSLGALSRDAMPTFRQVFLAGASGMALERRCYVVRKRAEHELGTKGPGQDGP
GRETVYFPSLSGQTLVYKGMLTTPQLKAFYLDLQDERLTSALGIVHSRFSTNTFPSWPLA
HPFRRIAHNGEINTVTGNENWMRAREALIKTDIFGSAADVEKLFPICTPGASDTARFDEV
LELLHLGGRSLAHAVLMMIPEAWERHESMDPARRAFYQYHASLMEPWDGPASMTFTDGTV
VGAVLDRNGLRPSRIWVTDDGLVVMASEAGVLDLHPSTVVRRMRLQPGRMFLVDTAQGRI
VSDEEIKADLAAEHPYQEWLDNGLVPLDELPEGKDVRMPHHRIVMRQLAFGYTYEELNLL
VAPMARLGAEPIGSMGTDTPVAVLSQRPRMLYDYFHQLFAQVTNPPLDAIREEVVTSLQG
TTGGERDLLNPDQNSCHQIVLPQPILRNHELAKLVSLDPNDKVNGRPHGLRSKVIRCLYR
VSEGGAGLAAALEEVRGAAAAAIADGARIIILSDRESDEEMAPIPSLLAVAGVHHHLVRE
RTRTQVGLVVESGDAREVHHMAALVGFGAAAINPYLVFESIEDMLDRGVIEGIDRTAALN
NYIKAAGKGVLKVMSKMGISTLASYTGAQLFQAVGISEQVLDEYFTGLTCPTGGITLDDI
AADVAARHRLAYLDRPDERAHRELEVGGEYQWRREGEYHLFNPETVFKLQHSTRTGQYKI
FKEYTRLVDDQSERMASLRGLLKFRTGVRPPVPLDEVEPASEIVKRFSTGAMSYGSISAE
AHETLAIAMNRLGARSNCGEGGEDVKRFDRDPNGDWRRSAIKQVASARFGVTSHYLTNCT
DLQIKMAQGAKPGEGGQLPGHKVYPWVAEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHD
LKNANPSARVHVKLVSENGVGTVAAGVSKAHADVVLISGHDGGTGATPLTSMKHAGAPWE
LGLAETQQTLLLNGLRDRIVVQVDGQLKTGRDVMIATLLGAEEFGFATAPLVVAGCIMMR
VCHLDTCPVGVATQNPLLRERFTGKPEFVENFFMFIAEEVREYLAQLGFRTVNEAVGQAG
ALDTTLARAHWKAHKLDLAPVLHEPESAFMNQDLYCSSRQDHGLDKALDQQLIVMSREAL
DSGKPVRFSTTIGNVNRTVGTMLGHELTKAYGGQGLPDGTIDITFDGSAGNSFGAFVPKG
ITLRVYGDANDYVGKGLSGGRIVVRPSDDAPQDYVAEDNIIGGNVILFGATSGEVYLRGV
VGERFAVRNSGAHAVVEGVGDHGCEYMTGGRVVILGRTGRNFAAGMSGGVAYVYDPDGEL
PANLNSEMVELETLDEDDADWLHGTIQVHVDATDSAVGQRILSDWSGQQRHFVKVMPRDY
KRVLQAIALAERDGVDVDKAIMAAAHG
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctaagcgcgtcgggttgtataaccccgcgttcgaacacgattcgtgcggggtt
gccatggttgtggacatgcacggccgtcgtagccgcgacatcgtggacaaggcgatcacc
gccctgctcaacctcgagcatcggggcgcgcaaggcgccgaaccccgcagcggtgacggc
gcgggcatcctgattcaggttccggacgaattccttcgcgaagccgtggatttcgagttg
cctgccccaggcagctatgccacgggtatcgcgttcttgccgcagtcatctaaagacgcc
gccgcggcctgcgccgccgtacagaaaatcgccgaggccgaggggctgcaagtcctgggt
tggcgcagcgtccccaccgacgactcatcgctgggcgcgctgtcccgtgatgccatgccc
accttccggcaggtgttcttggctggcgcgtccggcatggcgttggagcggcgctgctat
gtggtccgcaagcgggccgagcatgaactcggcaccaagggtccgggtcaagacgggccg
ggccgggaaaccgtgtacttcccgagcctgtccggccagacgctcgtctacaagggcatg
ctgaccaccccgcagctcaaggccttctacctcgatttgcaggacgagcgactgaccagc
gcgctaggcatcgtgcactcgcggttctccacgaacactttcccgtcctggccgctggcg
catccattccggcggatcgcgcacaacggggagatcaacaccgtcaccggtaacgagaac
tggatgcgggcccgcgaggcgctgatcaagaccgacatctttgggtcggcggccgatgtc
gaaaagctgttcccgatctgtaccccgggtgcctcggacaccgcgcgcttcgacgaggtg
ctcgaactgctgcacctgggcggacgcagcctggcccacgcggtgctgatgatgatccct
gaggcctgggagcgccacgagtcgatggaccccgcgcggcgggcgttttaccagtatcac
gcctcgttgatggagccgtgggacggcccggcgtcgatgacgttcaccgacggcaccgtc
gtgggcgccgtgctggaccgcaatggcctacgcccgtcgcgaatctgggtcaccgacgac
ggtttggtggtgatggcttccgaggccggtgtgttggacctgcatccgtcgacggtggtg
cgccggatgcggctgcagccgggccggatgttcttggtggacaccgcgcagggccgcatc
gtctccgatgaggagatcaaggccgacctggcggccgagcatccgtatcaggagtggctt
gacaacggactagttccgctcgacgaattgccggagggcaaagacgtgcggatgccccac
catcgaatcgtcatgcggcagttggcattcggctatacctacgaggagctcaacctgctg
gtagcgccgatggctcggctcggtgccgagccaatcgggtcgatgggcaccgacactcca
gttgcggtgttgtcgcagcgtccgcgcatgctctacgactacttccatcagctgttcgcc
caggtgaccaacccgccgttggacgccatccgcgaggaggtggtgaccagcctgcagggc
accaccggcggcgaacgtgacttgctcaacccggaccagaactcctgccaccagatcgtg
ctgccccagccgattctgcgtaaccacgagctcgccaagctggtcagcctcgatcccaac
gacaaggtcaatgggcgcccacacggattgcggtccaaggtgattcgctgtctgtaccgg
gtctccgagggaggtgctgggctggctgccgcgctggaagaggtacgtggcgcggcggcg
gcggcaatcgccgacggcgctcggatcatcatcttgtccgaccgcgagtccgacgaggaa
atggctccgataccgtcgctgctcgccgttgcgggagtgcaccaccacctggttcgggaa
cggacccgcacccaagtgggtctggtggtcgagtccggtgatgcccgcgaggtgcaccac
atggccgcgctggtcggattcggcgcggccgcgatcaacccctacctggtgttcgagtcg
atcgaggacatgctcgaccgcggtgttatcgagggcatcgaccgtacggcggcgctgaac
aactacatcaaagccgcaggtaagggtgtgctgaaagtgatgtcgaagatgggcatctcg
acgctggcctcctacaccggtgcgcaactgttccaggctgtcggcatctccgagcaagtg
ctcgacgaatacttcaccgggcttacctgccccaccggcgggatcaccctggatgacatc
gcggccgatgtcgcagcccggcaccggctggcctatctggaccggccggacgaacgcgct
caccgcgaactcgaggtgggtggggaataccagtggcgccgcgagggcgagtaccacctg
ttcaacccggagactgtgttcaagctgcagcactccacgcgaaccggccagtacaagatc
ttcaaggagtacacccgtctggtcgacgaccagagcgagcggatggcatcgctgcgtggt
ctgctcaagttccgtaccggggttcgtcctccagtcccgctggacgaggtcgagccggcc
agcgaaatcgtcaagcgcttctcaacgggggcgatgagctacggctcgatttccgctgaa
gcgcacgagacgctggccatcgcaatgaaccggcttggtgcccggtcaaactgtggtgaa
ggcggcgaggacgtcaagcgatttgaccgcgaccccaacggggattggcgccgaagcgcc
attaagcaggtagcctccgcccggtttggcgtcacctcgcattacctgaccaactgcacc
gacctccagatcaagatggcgcagggcgcgaaacctggtgagggaggtcagcttccgggg
cacaaggtgtacccttgggtggccgaggtccggcactccacgcccggtgtcggtctgatc
tcaccgccgccccaccacgacatctactccattgaggatctggcgcagctgatccacgac
ctaaagaacgccaatccatccgcgcgggtacacgtcaagctggtctccgaaaacggggta
gggacggttgcggctggcgtttccaaagcccacgccgacgtggtcttgatctcagggcac
gatggtggcaccggcgcgaccccgctgacatcgatgaagcacgccggagcaccctgggag
ttgggtctggctgagacacagcagacgttgctgctcaacgggttacgtgatcgaattgtg
gtccaggtggacggtcagctcaagacgggtcgcgatgtgatgatcgctacgctgctcggg
gcagaagagttcggattcgcgaccgcgccgttggtagtggccggctgcatcatgatgcgg
gtgtgccacctggacacgtgcccggttggtgtggccacccagaatccgttgctccgggag
cggttcaccgggaagcccgagttcgtggagaacttcttcatgttcatcgccgaggaagtc
cgggaatatttggcgcagttgggcttccgcactgtgaacgaggcggttggacaggcaggt
gcgctggacaccacgctggcacgcgcgcactggaaggcgcataagctggatctggcgccg
gtgctccacgagccggagtcggccttcatgaatcaggatctgtactgcagttcgcgccag
gatcacggtctagacaaggcgctcgatcagcagctgatcgtgatgagcagggaagcactg
gattccggcaagccggtccgcttctccaccaccataggcaatgtcaaccgcacggtgggc
accatgctcggccacgagctgacgaaggcctatggcggccaaggcttgccggacggaacc
atcgatatcacgttcgacggatccgcgggaaacagcttcggagccttcgtgcccaaggga
attaccttgcgggtgtatggcgacgccaatgactacgtcggcaaagggctatccggtggc
cggattgtggtgcggccgtcggatgacgcgccgcaggattatgtcgccgaggacaacatc
atcgggggcaatgtgattctgttcggcgcaaccagtggcgaggtttacctgcgcggtgtg
gtaggcgaacggttcgcggtgcgcaattccggggcccacgccgtggtagagggtgtcggc
gatcacggctgcgagtacatgaccggcggcagggttgtcattctgggccgcaccggccgt
aactttgcggcgggtatgtccggcggtgtggcctatgtttacgatcccgacggtgaactg
ccggccaacctcaactcggagatggtcgaactcgagaccctcgacgaggatgacgcggac
tggctgcacggcaccatacaagtgcacgtcgacgctaccgattccgctgtcggccagcgg
attctgtccgactggtcgggacagcagcgccacttcgtcaaggtgatgccgcgtgactac
aaacgggtcctgcaggcgatcgccctggctgaacgtgacggcgttgatgtcgacaaggcg
atcatggcggctgcgcatggctga

DBGET integrated database retrieval system