KEGG   Mycobacterium tuberculosis H37Rv: Rv3913Help
Entry
Rv3913            CDS       T00015                                 

Gene name
trxB2
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv3913 (trxB2)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv3913 (trxB2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Rv3913 (trxB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
4401728..4402735
Genome map
AA seq 335 aa AA seqDB search
MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVEN
YPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVIL
AMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARS
VTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTA
AGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgcctgtccatgaccgcgcacaccaccccgttcgcgacgtgatcgttatc
ggctccggtcccgcggggtacactgcggcgctctacgccgcccgtgcccagctggcgccg
ctggtcttcgagggcacgtctttcggcggcgcgctgatgaccaccaccgacgtggagaac
tacccgggatttcgcaacggcatcaccggtccagagttgatggatgagatgcgggaacag
gcgctgcgattcggcgcggacctgcgtatggaagacgtcgagtcggtatcacttcacggg
ccgctgaaatcggtcgtcaccgccgacggacagacccaccgggcccgagccgtgatcctg
gcaatgggcgcagcggcacgctatctgcaggtgcccggcgaacaggaattgctcgggcgc
ggggtgagctcgtgcgccacctgcgacggattcttcttccgcgatcaggacatcgccgtc
atcggcggcggtgactcggcaatggaggaagctaccttcctgacccgattcgctcgcagt
gtgacgctggtgcatcgccgcgacgagttccgggcttccaaaatcatgctcgatcgcgcc
cgcaacaacgacaagatacggttcctcaccaaccacaccgtggtcgcggtggacggggac
accacagtgaccggcttgcgggtacgcgacaccaacaccggtgccgaaaccaccctgccg
gtaaccggtgttttcgtcgcgatcggccacgagccgcggtcgggcttggtgcgcgaggcc
atcgacgtcgacccggacggctacgtgttggtgcaggggcgtaccaccagcacctcactg
ccgggcgtgttcgctgccggcgacctggtggatcgcacctatcgccaggcggttaccgca
gcgggcagtggctgcgccgcggctatcgacgccgagcgctggctcgccgagcacgcagca
accggagaagctgacagtaccgacgcattgataggagcacaacgatga

DBGET integrated database retrieval system