KEGG   Mycobacterium tuberculosis H37Rv: Rv0222Help
Entry
Rv0222            CDS       T00015                                 

Gene name
echA1
Definition
(RefSeq) enoyl-CoA hydratase EchA1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00071  Fatty acid degradation
mtu00280  Valine, leucine and isoleucine degradation
mtu00281  Geraniol degradation
mtu00310  Lysine degradation
mtu00360  Phenylalanine metabolism
mtu00362  Benzoate degradation
mtu00380  Tryptophan metabolism
mtu00410  beta-Alanine metabolism
mtu00627  Aminobenzoate degradation
mtu00640  Propanoate metabolism
mtu00650  Butanoate metabolism
mtu00903  Limonene and pinene degradation
mtu00930  Caprolactam degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01212  Fatty acid metabolism
Module
mtu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv0222 (echA1)
   00650 Butanoate metabolism
    Rv0222 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv0222 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv0222 (echA1)
   00310 Lysine degradation
    Rv0222 (echA1)
   00360 Phenylalanine metabolism
    Rv0222 (echA1)
   00380 Tryptophan metabolism
    Rv0222 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv0222 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv0222 (echA1)
   00281 Geraniol degradation
    Rv0222 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rv0222 (echA1)
   00627 Aminobenzoate degradation
    Rv0222 (echA1)
   00930 Caprolactam degradation
    Rv0222 (echA1)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rv0222 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-GeneID: 886723
NCBI-ProteinID: NP_214736
TubercuList: Rv0222
UniProt: L0T313 P96404
Structure
PDB: 

Jmol
Position
265507..266295
Genome map
AA seq 262 aa AA seqDB search
MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQLDGDAGLSVA
ILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIAAVEGYALAGGTELALA
ADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLPAERAHELGL
VNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFT
SNDAKEGAIAFAERRRPRWTGT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgaaagcgacgcagccaacaccgaacctgaggttctggtagaacagcgggat
cggattttgatcatcacgatcaaccgcccgaaagccaagaacgcggtcaacgccgcagtc
agccggggcttggccgatgcgatggatcagcttgacggcgatgccggcctgtcggtggca
atcctgaccggtgggggcggttcgttctgcgcgggcatggacctcaaggcgttcgcccgg
ggcgagaatgtcgtcgtcgaaggtcgcggccttggctttaccgaacgtccgccgaccaag
ccgctcattgctgcggtggaaggctacgcgttggcgggtggcaccgagctggcgcttgct
gccgacctgatcgtggcggccagggattcggcgttcgggattcctgaagtcaagcggggt
ctggttgccggcggcgggggattgctgcggttgccggagcgcatcccgtatgcgatagcc
atggagttggcgctgaccggtgacaacctaccggccgaacgcgcgcacgagctggggctc
gtcaacgttttggccgagccggggaccgccctcgatgctgcgatcgcgttggcggagaag
atcaccgccaatgggccgctggcggtggtggccaccaagcggattatcaccgagtcgcgt
gggtggagtcccgacactatgttcgctgagcagatgaagatcctggtgccggtgttcacc
tccaacgacgcgaaggaaggtgcgatcgcgttcgccgagaggcgccggccccgttggacg
ggcacctag

DBGET integrated database retrieval system