KEGG   Mycobacterium tuberculosis H37Rv: Rv0260cHelp
Entry
Rv0260c           CDS       T00015                                 

Definition
(RefSeq) transcriptional regulator
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0260c
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rv0260c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 886651
NCBI-ProteinID: NP_214774
TubercuList: Rv0260c
UniProt: L0T2Z7 P95217
Position
complement(311514..312659)
Genome map
AA seq 381 aa AA seqDB search
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEAL
IADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREE
WSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFLGGLRFAGAQVVPIRVYR
WKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM
CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKN
IVATVVKRGYRLAVDSRHDDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcacactcggcgccactgaccggctaccggatcgcggtgacatccgctcgc
cgcgccgaagagctgtgcgcattgcttcgccgccagggcgccgaggtctgtagtgcccca
gcgatcaagatgatcgcgcttcccgacgacgatgaactgcagaacaacaccgaggcgttg
atcgccgacccgcctgacattctggtcgcccacaccggcatcggatttcgcggctggttg
gccgcggccgaggggtgggggctggccaacgagctcctggaatcgttgtcgtcggcccgg
atcatctcccgcggaccaaaggcaactggtgcgctgcgtgccgccggcctgcgtgaagag
tggtcccccgactctgaatcgtcgcatgaagtgctggaatatctgctcgaatcgggggtg
tcccgtacgcgtattgccgtccagctgcacggtgccgccgacagctgggacccgtttccg
gaatttctgggcgggttacgtttcgccggcgcgcaagtggtgccgatccgggtttaccgg
tggaagccggcgccactaggcggcgtgttcgaccatttagtcaccgggatcgcgcgacga
caattcgacgcggtcaccttcacgtcggcacctgccgcagccgcggtgctagaacgcagc
cgtgaattggatatcgaggaccaactgttggctgcgctgcgtaccgacgtgcacgcgatg
tgtgtcggcccggtaacttcgcggccgttgatccgaaagggcgtcccgacgtcggctccc
gagcgaatgcggttgggagccttagcccgccacattgccgaggagctgccgctgctgggt
tcgtgcacgttcaaagcagccggccacgtgatcgagatccgtggaacctctgtgctggtg
gatgattcggtgaagccactatcgccgtccggaatggcgattttgcgcgcgttggtacat
cgccccggcggcgtcgtctctcgtggcgacttgctacgcgtcctacccggcgacggcagc
gacacccacgccgtggacaccgccgtcctgcggctacgaacggctctgggcgacaagaac
atcgtggcaacagtggtgaaacgtggctaccgtctcgccgttgacagccggcacgatgac
gtatga

DBGET integrated database retrieval system