KEGG   Mycobacterium tuberculosis H37Rv: Rv0629cHelp
Entry
Rv0629c           CDS       T00015                                 

Gene name
recD
Definition
Probable exonuclease V (alpha chain) RecD (exodeoxyribonuclease V alpha chain) (exodeoxyribonuclease V polypeptide)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mtu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(720005..721732)
Genome map
AA seq 575 aa AA seqDB search
MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTV
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL
HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG
ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctgtatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgactggcgggcctggcaccgggaagacgacgacggtc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtacggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccaggatcgccagaaccgg
ttgcctcacaacgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggcggatttggtcgatggcttctcggtacgc
gacgacgcgctggtggcgcagctgcgaacgtcgcatcggttcggcaaggtgatcggtacc
ttggccgaagcgatccgggccggcgatggcgatgccgtactgggcctgctgcgctcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcgcggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccaccggcgtgctg
cactggaaccgccgggttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccaccggtctgcgggccgtcatttctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgagaccatgcacgcg
atgaccatccacaagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtgacccgggccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcacgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtggctga

DBGET integrated database retrieval system