KEGG   Mycobacterium tuberculosis H37Rv: Rv0905Help
Entry
Rv0905            CDS       T00015                                 

Gene name
echA6
Definition
enoyl-CoA hydratase EchA6
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Rv0905 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv0905 (echA6)
   00650 Butanoate metabolism
    Rv0905 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv0905 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv0905 (echA6)
   00310 Lysine degradation
    Rv0905 (echA6)
   00360 Phenylalanine metabolism
    Rv0905 (echA6)
   00380 Tryptophan metabolism
    Rv0905 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv0905 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv0905 (echA6)
   00281 Geraniol degradation
    Rv0905 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rv0905 (echA6)
   00627 Aminobenzoate degradation
    Rv0905 (echA6)
   00930 Caprolactam degradation
    Rv0905 (echA6)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rv0905 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1008207..1008938
Genome map
AA seq 243 aa AA seqDB search
MIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLTGQGTAFCAGA
DLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIGTLADAQAW
AAEIARLAPLAIQHAKRVLNDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtatcacccaggcagaagccgtgctgaccattgagctgcaacgcccggagcgc
cgcaacgccttaaattcccagctggtcgaggagcttacgcaggccatccggaaagccggg
gatggatcggctcgggcgatcgtgctgaccggccaaggcaccgcgttctgcgctggcgcg
gacctgagcggagacgcattcgccgccgattatcccgaccggctcatcgagctgcacaag
gcgatggacgcctccccgatgccagtggtcggcgcgatcaacggtcccgccatcggcgcc
ggcttgcagcttgccatgcaatgcgacctgcgggttgtcgcgcccgatgccttcttccag
tttccgacgtcgaaatacggtctggccctggataactggagcatccgccggctgtcgtcg
ttggttgggcacggacgtgcccgcgcgatgctgctcagcgcggaaaagctgaccgccgag
atcgcactgcacaccggaatggcgaatcgcattggcactttggccgacgcccaggcctgg
gccgccgagatcgccaggctggcaccactggctatccagcacgccaagcgggtgctcaac
gacgacggcgctatcgaggaagcgtggccggcccataaggaactcttcgacaaagcctgg
ggcagccaggatgtcatcgaagcgcaggttgcccggatggaaaagcggccgccgaagttc
caaggggcttaa

DBGET integrated database retrieval system