KEGG   Mycobacterium tuberculosis H37Rv: Rv0914cHelp
Entry
Rv0914c           CDS       T00015                                 

Definition
(RefSeq) lipid carrier protein or keto acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00071  Fatty acid degradation
mtu00072  Synthesis and degradation of ketone bodies
mtu00280  Valine, leucine and isoleucine degradation
mtu00310  Lysine degradation
mtu00362  Benzoate degradation
mtu00380  Tryptophan metabolism
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu00650  Butanoate metabolism
mtu00900  Terpenoid backbone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01212  Fatty acid metabolism
mtu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv0914c
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0914c
   00640 Propanoate metabolism
    Rv0914c
   00650 Butanoate metabolism
    Rv0914c
  Lipid metabolism
   00071 Fatty acid degradation
    Rv0914c
   00072 Synthesis and degradation of ketone bodies
    Rv0914c
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv0914c
   00310 Lysine degradation
    Rv0914c
   00380 Tryptophan metabolism
    Rv0914c
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv0914c
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rv0914c
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv0914c
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rv0914c
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0914c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 885046
NCBI-ProteinID: NP_215429
TubercuList: Rv0914c
UniProt: L0T835 I6XWJ8
Position
complement(1018727..1019965)
Genome map
AA seq 412 aa AA seqDB search
MDDGVWILGGYQSDFARNLSKENRDFADLTREVVDGTLTAAKVDAADLAAAGVVHVANAF
GEMFARQGHLGAMPATVCDDLWDTPATRHEAACASGSVATLAAMADLRSGAYRVALVVGL
ELEKTVPGDTAAEHLSAAAWTGHEGAEARYLWPSMFAQVADEYDRRYGLDDTHLRAIAQL
NFANARRNPNAQTRGWTIPDPITDDDATNPLTEGRLRRFDCSQMTDGGAGLVLVSDAYLR
DHRDARPIGRIDGWGHRTVGLGLRQKLDRVAQGDSAPYLLPHVRATVLDALRRARVTLDD
LDGIEVHDCFTPSEYLAIDHIGLTGPGESWKAIENGEIEIGGRLPINPSGGLIGGGHPVG
ASGVRMLLDAAKQVSGIAGDYQVENAEAFGTLNFGGSTATTVSFVVSTTRGS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggacgacggtgtctggattctcggcggctatcagagcgattttgctcgcaacctcagc
aaagagaaccgcgacttcgccgacctgactagggaggtcgtcgacggcacgctcaccgcg
gccaaggtggacgccgccgacctagccgctgcgggagtcgtccacgtcgcgaacgccttc
ggcgagatgttcgcccgtcaaggccacctcggcgcgatgccggccactgtctgcgacgat
ctctgggacacgccggccacccggcacgaggccgcgtgcgcatccggcagcgtggcgacg
ctcgcggcgatggccgacctgcgatcaggcgcgtaccgtgtcgcgctcgtcgtgggccta
gagctggagaagaccgtgcccggcgacaccgcggccgagcatctgagtgccgcggcctgg
accgggcacgaaggagccgaggcccgctacttatggccgtcgatgttcgctcaggtcgcc
gacgaatacgaccggcgatacggtttggatgacactcacctgcgggccatcgctcaactc
aacttcgccaacgcgcgccgcaaccccaacgcgcagacccgcggctggacgatccccgac
ccgatcaccgacgacgacgcgaccaaccctcttaccgaaggccggctgcgacggtttgat
tgcagccagatgaccgacggcggcgcgggattggtcctggtcagcgatgcctatctgcgc
gaccatcgcgacgcgcgcccgatcggccgcatcgacggctggggacatcgcaccgtcggg
ttgggtctgcggcagaaactggaccgcgtcgcccagggcgactcggccccctacctactg
ccgcacgtgcgggccacagtgctggacgccctgcgccgcgcccgggtgaccctcgacgat
ctggacgggatcgaggtgcacgactgcttcacccccagcgaatacctggccatcgatcac
atcgggttgaccggccccggggaatcttggaaggccatcgagaacggagagatcgagatc
ggcgggcggctacccatcaaccccagcggaggactgatcggtggcggacatccggtcggg
gcttccggtgtgcggatgctgctcgacgcggccaaacaggtgagcggcattgccggtgac
tatcaggtcgagaacgccgaagcgttcggcacgctgaatttcggtggcagcacggccacc
acggtcagtttcgttgtcagcaccacacgaggatcgtga

DBGET integrated database retrieval system