KEGG   Mycobacterium tuberculosis H37Rv: Rv0951Help
Entry
Rv0951            CDS       T00015                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00640  Propanoate metabolism
mtu00660  C5-Branched dibasic acid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv0951 (sucC)
   00640 Propanoate metabolism
    Rv0951 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Rv0951 (sucC)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rv0951 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Baculo_E25
Motif
Other DBs
NCBI-GeneID: 885434
NCBI-ProteinID: NP_215466
TubercuList: Rv0951
UniProt: P9WGC5 I6Y586
Position
1061964..1063127
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVK
YAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELF
VAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRIL
TEANHPLVTLVATMDEAADKAAELASA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttcgagtatcaagccaaggagttattcgccaagcacaacgtgcccagcacg
ccgggtcgggtgaccgacacagccgagggtgccaaggctatcgccacggagatcgggcgt
ccggtgatggtcaaagcgcaggtcaagatcggcggccggggcaaggccggtggcgtcaaa
tacgccgcgaccccacaagacgcgtacgagcacgccaagaacatcctcggcctggacatc
aaaggacacatcgtcaagaaactgctggtcgctgaggctagcgatatcgccgaggagtac
tacctatccttcctgctcgaccgggccaaccgcacctacctggcgatgtgctcggtggag
ggcggcatggagatcgaagaggtagcggccaccaaacccgagcggctcgccaaagtcccg
gtgaatgccgtcaagggcgttgacctagatttcgcgcggtccatcgccgaacagggtcat
cttccggccgaggtgctcgacaccgcagcggtcaccatcgccaagctgtgggagctcttc
gtcgccgaggacgcgacgctggttgaggtcaacccgttggtgcggacgcctgaccacaag
atcctcgcgctggatgccaagatcaccctcgacggcaacgccgatttccgtcagcctggc
catgccgagttcgaggatcgagctgccaccgatccactggagttgaaggccaaggagcac
gacctcaactacgtcaagctggacggtcaggtggggatcatcggcaatggcgcgggcttg
gtgatgtcgactctcgacgtcgtcgcgtatgccggtgagaagcacggcggagtcaagccg
gccaacttcctggatatcggcggcggcgcttcggccgaggtgatggccgcgggtctggac
gtggtgctgggcgaccagcaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgcgatgcggtggcgaccgggatcgtcaaggcgctgggcatgctgggtgacgaagcc
aacaagccgctggtggttcggctcgacggcaacaacgtcgaggaaggccgtcgcatcctg
accgaggccaaccaccccctggtgacactggtggcgacgatggacgaagccgccgacaag
gccgctgagctggcgagcgcctga

DBGET integrated database retrieval system