KEGG   Mycobacterium tuberculosis H37Rv: Rv1011Help
Entry
Rv1011            CDS       T00015                                 

Gene name
ispE
Definition
Probable 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mtu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1130191..1131111
Genome map
AA seq 306 aa AA seqDB search
MPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTVFHAVSLVDEVTVRNADVLSLELVGEG
ADQLPTDERNLAWQAAELMAEHVGRAPDVSIMIDKSIPVAGGMAGGSADAAAVLVAMNSL
WELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADSGLL
TSAVYNELDRLREVGDPPRLGEPGPVLAALAAGDPDQLAPLLGNEMQAAAVSLDPALARA
LRAGVEAGALAGIVSGSGPTCAFLCTSASSAIDVGAQLSGAGVCRTVRVATGPVPGARVV
SAPTEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccgggtcggtcaccgttcgggtgcccggaaaggtcaacctctatctggcggtc
ggcgatcgccgcgaggacggctatcacgagctgaccacggtatttcatgccgtctcgctg
gtcgacgaggtaaccgttcgtaacgctgatgtgctctcgctcgagttggtcggcgagggg
gccgaccagctgccgaccgacgaacgcaatctcgcctggcaggcggccgagctgatggcc
gaacacgtgggccgggcgccggacgtctcgatcatgatcgacaaatccattccggtcgcc
ggcggcatggccggtggcagcgcggacgctgcggcggtcctggttgcgatgaactcgttg
tgggaactcaatgtgccccgccgcgacctgcgcatgctcgccgcgcggctaggcagcgat
gtgccgtttgccctgcatggtggtaccgcgctggggacgggtcgcggcgaggagttggcc
accgtgttatcccgcaacaccttccactgggtcctggcgttcgccgacagcgggttgctc
acctccgcggtgtacaacgagctcgaccggctcagggaggtgggggatccgccccggctt
ggtgagcccgggccggttctggctgccttagctgcgggtgatccggatcagctggcgccg
ttgctgggtaatgaaatgcaagcggccgcggtgagcctggacccggcgctggctcgtgcg
ttacgcgccggtgtggaggccggcgcgctcgcaggcatcgtgtccggttcgggtcccacg
tgtgccttcctgtgcacctcggcgagctcggcgatcgatgtcggcgcgcagctgtcgggg
gcgggagtttgtcgcaccgttcgagtcgccaccgggccggtacccggcgcccgcgtggtg
tctgcgccgaccgaagtgtga

DBGET integrated database retrieval system