KEGG   Mycobacterium tuberculosis H37Rv: Rv1141cHelp
Entry
Rv1141c           CDS       T00015                                 

Gene name
echA11
Definition
(RefSeq) enoyl-CoA hydratase EchA11
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00071  Fatty acid degradation
mtu00280  Valine, leucine and isoleucine degradation
mtu00281  Geraniol degradation
mtu00310  Lysine degradation
mtu00360  Phenylalanine metabolism
mtu00362  Benzoate degradation
mtu00380  Tryptophan metabolism
mtu00410  beta-Alanine metabolism
mtu00627  Aminobenzoate degradation
mtu00640  Propanoate metabolism
mtu00650  Butanoate metabolism
mtu00903  Limonene and pinene degradation
mtu00930  Caprolactam degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01212  Fatty acid metabolism
Module
mtu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv1141c (echA11)
   00650 Butanoate metabolism
    Rv1141c (echA11)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv1141c (echA11)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv1141c (echA11)
   00310 Lysine degradation
    Rv1141c (echA11)
   00360 Phenylalanine metabolism
    Rv1141c (echA11)
   00380 Tryptophan metabolism
    Rv1141c (echA11)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv1141c (echA11)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv1141c (echA11)
   00281 Geraniol degradation
    Rv1141c (echA11)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rv1141c (echA11)
   00627 Aminobenzoate degradation
    Rv1141c (echA11)
   00930 Caprolactam degradation
    Rv1141c (echA11)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rv1141c (echA11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 YdjM
Motif
Other DBs
NCBI-GeneID: 886024
NCBI-ProteinID: NP_215657
TubercuList: Rv1141c
UniProt: A0A089QKY7 O06541
Position
complement(1268203..1269009)
Genome map
AA seq 268 aa AA seqDB search
MPDSGIAALTPVTGLNVTLTDRVLSVRINRPSSLNSLTVPILTGIADTLERAAADPVVKV
VRLGGVGRGFSSGVSMSVDDVWGGGPPTAIVEEANRAVRAVAALPHPVVAVVQGPAVGVA
VSLALACDFILASDSAFFMLANTKVALMPDGGASALVAAATGRIRAMRLALLAEQLPARE
ALAWGLISAVYPDSDFEAEVDKVISRLLAGPALAFAQAKNAINAAALTELEPTFARELDG
QEVLLRTHDFAEGAAAFLQRRTPNFTGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccagattccgggattgccgcattaacgccggtcacaggcctcaacgtcaccctgacc
gacagagtgttgtcggtgcgcatcaaccgccctagcagtctcaactcgctgaccgtgcca
atcctgacggggatcgccgacacgctggagcgcgcggcggccgatcccgtggtcaaggtg
gtgcgcctaggcggggtgggccgcggtttcagctccggagtgtctatgtctgtggacgat
gtgtggggcggagggccgccgaccgccatcgtcgaagaggccaaccgcgcagtacgcgcc
gtggccgcgctaccgcacccggttgtagctgtcgttcaaggaccagcggtcggcgtcgct
gtctcgctagcgctggcgtgtgacttcatattggcttctgatagtgcatttttcatgctc
gccaacaccaaggtagcgttgatgcccgacggcggcgcatcggcgttagtcgccgcggcc
accggccggatccgggcgatgcggctggcgctgctggccgagcaactgccggcccgcgag
gcactggcctggggcctgatcagcgcggtatatccggacagcgacttcgaggccgaggtg
gacaaggtgatttcacggttgctggccggcccggcgctggcgttcgcccaggccaaaaac
gccatcaatgcagccgccctcaccgaattggaacccacgttcgcgcgcgaattggatgga
caggaagtcctgctgcgaacacacgacttcgccgagggcgcagcggcgttcctgcaacgc
cgcacccccaacttcaccggttcctga

DBGET integrated database retrieval system