KEGG   Mycobacterium tuberculosis H37Rv: Rv1188Help
Entry
Rv1188            CDS       T00015                                 

Definition
proline dehydrogenase
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv1188
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     Rv1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1331021..1332010
Genome map
AA seq 329 aa AA seqDB search
MAGWFAHTLRPAMLAAGRSDRLGRIVERSPLTRGVVRRFVPGDTLDDVVDIVTALRDSGR
YLSIDYLGENVTDADDAAAAVRAYLGLLDVLGRRGDIACDGVRPLEVSLKLSALGQALDR
DGQKIALDNARAICERAERVGAWVTVDAEDHTTTDSTLSISGDLRVDFPWLGTVVQAYLR
RTLADCAELAAVGARVRLCKGAYDEPASVAYRDAAQVTDSYLRCLRVLTAGRGYPMVATH
DPVIIAAVPGITRESGRSQGDFEYQMLYGVRDDEQRRLTGAGNHVRVYVPFGTRWYGYFL
RRLAERPANLAFFLRALTDRRRARGCAER
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggccggctggttcgcgcacacgctgcgcccggcaatgcttgccgccggccgctcggat
cggctgggccgcatcgtcgagcgctcgccgctcacccgcggggtggtgcgccggttcgtg
cccggcgacacgctcgacgacgtggtggatatcgttaccgcgctgcgggattcgggccgc
tacctcagcatcgactacctgggcgagaacgtcaccgatgccgacgacgctgccgccgcc
gtgcgggcgtacctggggctcttggacgtgctgggccgccgcggcgatatcgcatgcgac
ggggtgcgaccgctcgaggtgtcgctcaagctgtcggcgctcgggcaggccctcgatcgc
gacggccagaagatcgcgctggacaacgcccgcgccatctgtgagcgggccgagcgggtg
ggcgcctgggtcacggtggacgccgaagaccacaccaccaccgattccacattgtcgata
tcgggcgatttgcgcgtcgactttccttggctgggcacggttgtgcaggcctatctgcgg
cgcacgctggccgattgcgcggagttggcggccgtgggcgcccgagtccggttgtgcaag
ggcgcctatgacgaacccgcatcggtggcctaccgagacgccgcgcaggtcaccgactcc
tatctgcggtgccttcgggtattgacggcggggcgaggctatccgatggtggccacccac
gacccggtgatcatcgcggcggtaccggggatcacgcgcgaatcagggcgtagtcaaggt
gatttcgaataccagatgctctacggcgtccgcgacgacgaacaacgacgactgaccggc
gccggtaaccacgtgcgggtgtatgtgcccttcggcacccggtggtacgggtatttcctg
cggcggctggccgaacgcccggccaacctggcgttcttcctgcgggcgctgaccgaccgc
cgacgcgcgcgggggtgcgccgagcgctga

DBGET integrated database retrieval system