KEGG   Mycobacterium tuberculosis H37Rv: Rv1188Help
Entry
Rv1188            CDS       T00015                                 

Definition
Probable proline dehydrogenase
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1331021..1332010
Genome map
AA seq 329 aa AA seqDB search
MAGWFAHTLRPAMLAAGRSDRLGRIVERSPLTRGVVRRFVPGDTLDDVVDIVTALRDSGR
YLSIDYLGENVTDADDAAAAVRAYLGLLDVLGRRGDIACDGVRPLEVSLKLSALGQALDR
DGQKIALDNARAICERAERVGAWVTVDAEDHTTTDSTLSISGDLRVDFPWLGTVVQAYLR
RTLADCAELAAVGARVRLCKGAYDEPASVAYRDAAQVTDSYLRCLRVLTAGRGYPMVATH
DPVIIAAVPGITRESGRSQGDFEYQMLYGVRDDEQRRLTGAGNHVRVYVPFGTRWYGYFL
RRLAERPANLAFFLRALTDRRRARGCAER
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggccggctggttcgcgcacacgctgcgcccggcaatgcttgccgccggccgctcggat
cggctgggccgcatcgtcgagcgctcgccgctcacccgcggggtggtgcgccggttcgtg
cccggcgacacgctcgacgacgtggtggatatcgttaccgcgctgcgggattcgggccgc
tacctcagcatcgactacctgggcgagaacgtcaccgatgccgacgacgctgccgccgcc
gtgcgggcgtacctggggctcttggacgtgctgggccgccgcggcgatatcgcatgcgac
ggggtgcgaccgctcgaggtgtcgctcaagctgtcggcgctcgggcaggccctcgatcgc
gacggccagaagatcgcgctggacaacgcccgcgccatctgtgagcgggccgagcgggtg
ggcgcctgggtcacggtggacgccgaagaccacaccaccaccgattccacattgtcgata
tcgggcgatttgcgcgtcgactttccttggctgggcacggttgtgcaggcctatctgcgg
cgcacgctggccgattgcgcggagttggcggccgtgggcgcccgagtccggttgtgcaag
ggcgcctatgacgaacccgcatcggtggcctaccgagacgccgcgcaggtcaccgactcc
tatctgcggtgccttcgggtattgacggcggggcgaggctatccgatggtggccacccac
gacccggtgatcatcgcggcggtaccggggatcacgcgcgaatcagggcgtagtcaaggt
gatttcgaataccagatgctctacggcgtccgcgacgacgaacaacgacgactgaccggc
gccggtaaccacgtgcgggtgtatgtgcccttcggcacccggtggtacgggtatttcctg
cggcggctggccgaacgcccggccaacctggcgttcttcctgcgggcgctgaccgaccgc
cgacgcgcgcgggggtgcgccgagcgctga

DBGET integrated database retrieval system