KEGG   Mycobacterium tuberculosis H37Rv: Rv1530Help
Entry
Rv1530            CDS       T00015                                 

Gene name
adh
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1530 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv1530 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rv1530 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv1530 (adh)
   00626 Naphthalene degradation
    Rv1530 (adh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv1530 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C DapB_N AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 886426
NCBI-ProteinID: NP_216046
TubercuList: Rv1530
UniProt: P9WQC3 I6Y6S9
Position
1731373..1732476
Genome map
AA seq 367 aa AA seqDB search
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAF
VPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMY
GFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKP
GDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDP
VAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVV
FKELRVLGALGVDATAYRAALDLLVSGRYPFASLPRRCVRLEGAEDLLATMAGERDGVPP
IHGVLTP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggcgcggtggtacgggcattggtattggaggcgccgcgcaggctggtcgtg
cgccagtaccggctgccgcgcatcggcgatgatgacgcactagtgcgagtagaggcctgc
gggctgtgcggcaccgatcacgagcaatacacgggcgagctggccggtgggtttgccttc
gtacctggccacgagacggtcgggacgattgcggccatcggtccgcgggcggagcagcgg
tggggcgtgtcggccggcgaccgagtagccgtcgaggtattccagtcgtgtcggcagtgc
gctaactgtcgtggcggcgagtaccggcgttgtgtacggcatggcctcgctgacatgtac
gggttcatcccggttgaccgagagcctggcctgtggggcggttacgccgaatatcagtac
ctggcgccggattcgatggtgttgcgggtggccggtgacctcagcccggaagtggccacc
ttgttcaacccgctgggggcgggaatacgttggggagtaacgattcccgaaaccaaaccg
ggcgacgtcgtggcggtgctgggtccaggaatccgggggctgtgcgccgccgcggcggca
aaaggggccggtgccgggttcgtgatggtgaccgggttgggaccccgtgacgccgaccgg
ttggcgctggcggcacagttcggagccgacctcgccgtcgatgttgcgatcgatgacccg
gtcgccgccctgaccgaacagaccggtgggctggcagacgtcgttgtcgacgtgaccgcc
aaggcgccagcggcattcgcacaggcgatagcgctagcccggcccgccgggaccgttgtt
gtcgccggcacccggggcgtgggcagcggggcaccgggattttcgcccgacgtcgttgtg
ttcaaggagctgcgtgtgcttggcgccctcggcgtagacgccaccgcctaccgggccgcg
cttgatctgttggtgtccggtcgataccccttcgcaagcctgcctcgccgctgcgtgcgg
ctcgaaggcgccgaggatctgctggctaccatggccggtgaacgcgacggtgtcccgcct
atccacggagtgctcacaccatga

DBGET integrated database retrieval system