KEGG   Mycobacterium tuberculosis H37Rv: Rv1703cHelp
Entry
Rv1703c           CDS       T00015                                 

Definition
methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rv1703c
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     Rv1703c
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv1703c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1929131..1929880)
Genome map
AA seq 249 aa AA seqDB search
MIRKARIAPLRWSVWRMAAGIRNITTTGQIGDGREAAAVDYVLAHAGAGNIDDVLATIDK
FAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYGALRIARAAPEARVYSVELA
EANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLDHDKKAYL
PDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLEYQTLVPD
LVLESEYLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaaagcgcgcattgccccgttgcggtggtcggtctggcggatggcggccggg
atccgcaatatcaccacgacgggccagatcggtgatggacgcgaagcggcggccgtcgac
tatgtcctcgcccacgccggggccggcaacatcgacgacgtgctggccaccatcgacaag
ttcgcctatgagaagtcgatgctcatcaacgtcggtgacgagaaagggacgctgctcgac
gcggcggttcggcgcgccgacccggcattggcgctggagttgggcacctacctcggctac
ggcgcgctgcggatcgcccgggccgctccggaggccagggtgtactccgtcgaactcgcc
gaagccaacgccagcaacgcccggcgaatatgggcgcatgccggcgtcgatgacagggtg
gtgtgcgtggtcggcaccatcggcgacggtgggcgcaccctggacgcgctaaccgagcac
ggattcgcaactggcacactcgattttgtgttcctcgaccatgacaagaaggcttacctg
cccgatctgcagagcatcctagaccggggctggttgcacccgggctcgatcgtggttgcc
gacaatgtcagggtgcccggcgcgccgaagtaccgtgcatatatgcgccggcaacaaggc
atgtcatggaacaccattgagcacaagacgcacctcgaataccagaccctggtgcccgac
ttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system