KEGG   Mycobacterium tuberculosis H37Rv: Rv1703cHelp
Entry
Rv1703c           CDS       T00015                                 

Definition
Probable catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mtu00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1929131..1929721)
Genome map
AA seq 196 aa AA seqDB search
MLATIDKFAYEKSMLINVGDEKGTLLDAAVRRADPALALELGTYLGYGALRIARAAPEAR
VYSVELAEANASNARRIWAHAGVDDRVVCVVGTIGDGGRTLDALTEHGFATGTLDFVFLD
HDKKAYLPDLQSILDRGWLHPGSIVVADNVRVPGAPKYRAYMRRQQGMSWNTIEHKTHLE
YQTLVPDLVLESEYLG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaccatcgacaagttcgcctatgagaagtcgatgctcatcaacgtcggtgac
gagaaagggacgctgctcgacgcggcggttcggcgcgccgacccggcattggcgctggag
ttgggcacctacctcggctacggcgcgctgcggatcgcccgggccgctccggaggccagg
gtgtactccgtcgaactcgccgaagccaacgccagcaacgcccggcgaatatgggcgcat
gccggcgtcgatgacagggtggtgtgcgtggtcggcaccatcggcgacggtgggcgcacc
ctggacgcgctaaccgagcacggattcgcaactggcacactcgattttgtgttcctcgac
catgacaagaaggcttacctgcccgatctgcagagcatcctagaccggggctggttgcac
ccgggctcgatcgtggttgccgacaatgtcagggtgcccggcgcgccgaagtaccgtgca
tatatgcgccggcaacaaggcatgtcatggaacaccattgagcacaagacgcacctcgaa
taccagaccctggtgcccgacttggtattggagtccgaatacctgggttag

DBGET integrated database retrieval system