KEGG   Mycobacterium tuberculosis H37Rv: Rv1905cHelp
Entry
Rv1905c           CDS       T00015                                 

Gene name
aao
Definition
Probable D-amino acid oxidase Aao
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mtu00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mtu00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mtu00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:mtu00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2151433..2152395)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDP
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacccc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system