KEGG   Mycobacterium tuberculosis H37Rv: Rv1916Help
Entry
Rv1916            CDS       T00015                                 

Gene name
aceAb
Definition
(RefSeq) isocitrate lyase AceAb
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
Module
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1916 (aceAb)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rv1916 (aceAb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL
Motif
Other DBs
NCBI-GeneID: 885383
NCBI-ProteinID: NP_216432
TubercuList: Rv1916
UniProt: O07717
Position
2161566..2162762
Genome map
AA seq 398 aa AA seqDB search
MTYGEAVADVLEFGQSEGEPIGMAPEEWRAFAARASLHAARAKAKELGADPPWDCELAKT
PEGYYQIRGGIPYAIAKSLAAAPFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNL
SPSFNWDTTGMTDEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLAL
ARLQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQHLVQTEVPR
KLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGESDDKLANVIFQPIQDRRGR
TILLVRDQNTFGAELRQKRLMTLIHLWLVHRFKAQAVHYVTPTDDNLYQTSKMKSHGIFT
EVNQEVGEIIVAEVNHPRIAELLTPDRVALRKLITKEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacctacggagaggccgtggcggacgtgctcgaattcggtcagagcgagggcgaaccc
attggcatggctcccgaggagtggcgggcgttcgccgcgcgtgcatcgctgcatgccgcc
cgggcaaaggccaaggagctgggcgccgatccgccatgggactgcgagctggccaagacc
ccggagggctactaccagatccgcggcggcataccgtatgcgatcgccaaatcgctggcc
gcggcaccgtttgccgacattctttggatggagaccaagaccgccgatctcgccgacgct
cgacagttcgccgaggcgatccatgccgagttccccgaccagatgctggcgtacaacctc
tcaccatcgttcaactgggacaccaccggcatgaccgacgaggagatgcggcgcttcccc
gaggagctcggcaaaatgggcttcgtcttcaacttcatcacctatggcgggcaccagatc
gacggtgtcgcggccgaggaattcgccaccgcgctgcgccaggacggcatgctggcgctg
gctcggttgcagcgcaagatgcgcttggtcgaatctccctatcgcacaccgcaaacgcta
gtcggcgggccgcgcagtgacgccgcattggctgcctcctccggacgcacggcgaccacg
aaggcaatgggcaagggctccacccagcaccagcacttggtgcaaactgaggtgccgcgc
aagctgctagaggaatggctggccatgtggagcggtcactaccagctcaaagacaaactg
cgcgtacagcttcggccgcagcgggccggctcggaggtgctcgagctcggcatccacggc
gaaagcgatgacaagctcgccaacgtgatattccaaccgatccaagatcgccgcggccgc
accatcctgttggtacgcgaccagaacacgttcggtgcggaactacgccaaaagcggctg
atgaccctgatccacctctggctcgtccaccgcttcaaggcgcaggcggtgcactacgtc
acgcccaccgacgacaacctctaccagacctcgaagatgaagtcgcatggaatcttcacc
gaggtcaaccaggaggtgggcgagatcatcgtcgccgaggtgaaccacccgcgcatcgcc
gaactgctgacgcccgatcgggtggcgctgcggaagttgatcacgaaggaggcgtag

DBGET integrated database retrieval system