KEGG   Mycobacterium tuberculosis H37Rv: Rv2215Help
Entry
Rv2215            CDS       T00015                                 

Gene name
dlaT
Definition
DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mtu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mtu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mtu00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2481965..2483626
Genome map
AA seq 553 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAKDAGEAAAPAPEKVPAAQPESKPAPEPPPVQPTSGAPAGGD
AKPVLMPELGESVTEGTVIRWLKKIGDSVQVDEPLVEVSTDKVDTEIPSPVAGVLVSISA
DEDATVPVGGELARIGVAADIGAAPAPKPAPKPVPEPAPTPKAEPAPSPPAAQPAGAAEG
APYVTPLVRKLASENNIDLAGVTGTGVGGRIRKQDVLAAAEQKKRAKAPAPAAQAAAAPA
PKAPPAPAPALAHLRGTTQKASRIRQITANKTRESLQATAQLTQTHEVDMTKIVGLRARA
KAAFAEREGVNLTFLPFFAKAVIDALKIHPNINASYNEDTKEITYYDAEHLGFAVDTEQG
LLSPVIHDAGDLSLAGLARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPIL
VPPQAAMLGTGAIVKRPRVVVDASGNESIGVRSVCYLPLTYDHRLIDGADAGRFLTTIKH
RLEEGAFEADLGL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggttacc
cgctggctcaaacaggaaggcgacacggtcgaactcgacgagcccctcgtggaggtgtcg
accgacaaggtcgacaccgaaatcccctcgccggccgcgggtgtgctgaccaagatcatc
gcccaggaggatgacacggtcgaggtcggcggcgagctcgctgtcattggcgacgccaag
gatgccggcgaggccgcggccccggcacccgagaaagtccctgcggcccaacccgagtcc
aagccggcacccgaaccaccaccggtccaaccgacgtccggagcgcctgctggtggcgat
gccaagccggtgctgatgcccgagctcggcgaatcggtgaccgaggggaccgtcattcgt
tggctgaagaagatcggggattcggttcaggttgacgagccactcgtggaggtgtccacc
gacaaggtggacaccgagatcccgtccccggtggctggggtcttggtcagtatcagcgcc
gacgaggacgccacggtgcccgtcggcggcgagttggcccggatcggtgtcgctgccgac
atcggcgccgcgcccgcccccaagcccgcacccaagcccgtccccgagccagcgccgacg
ccgaaggccgaacccgcaccatcgccgccggcggcccagccagccggtgcggccgagggc
gcaccgtacgtgacgccgctggtgcgaaagctggcgtcggaaaacaacatcgacctcgcc
ggggtgaccggcaccggagtgggtggtcgcatccgcaaacaggatgtgctggccgcggct
gagcaaaagaagcgggcgaaagcaccggcgccggccgcccaggccgccgccgcgccggcc
ccgaaagcgccgcctgcccctgcgccggcgttggcacatctacggggcaccacccagaag
gccagccggattcgtcagatcaccgccaacaagacccgcgaatctttgcaggcaacggca
cagctgacacaaacccatgaggtcgacatgaccaagatcgtggggctacgggcccgggcc
aaggcggcgttcgccgagcgtgagggcgtgaacctgaccttcctgccgttcttcgccaag
gccgtgatcgatgccctcaagattcacccgaacatcaacgctagctacaacgaggacacc
aaggagatcacctactacgacgccgagcacctaggattcgctgtcgacaccgagcagggc
ctgctctccccggtcatccacgacgccggcgatctgtcactggccggtctggcgcgggcg
atcgccgatatcgcggcccgtgcccggtcgggcaacctgaaacccgacgagttgtccggc
ggcaccttcaccatcaccaacatcggtagccagggcgcgttgttcgacaccccgatcctg
gttccgccgcaggccgccatgctgggcaccggggcgatcgtcaagcggccgcgggtggtc
gtcgatgccagcggcaacgagtcgatcggggtgcgctcggtctgctacctcccgttgacc
tatgaccatcggctcatcgacggcgccgacgccggacgtttcctcaccacgatcaagcac
cgcctcgaagagggagcgttcgaggccgatttaggactgtga

DBGET integrated database retrieval system