KEGG   Mycobacterium tuberculosis H37Rv: Rv2981cHelp
Entry
Rv2981c           CDS       T00015                                 

Gene name
ddlA
Definition
D-alanine--D-alanine ligase
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rv2981c (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2981c (ddlA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rv2981c (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3336796..3337917)
Genome map
AA seq 373 aa AA seqDB search
MSANDRRDRRVRVAVVFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTD
ANPDALTITNRELPQVKSGSGTELALPADPRRGGQLVSLPPGAGEVLESVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLH
RQECERLGLPVFVKPARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELEC
GVLEMPDGTLEASTLGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQ
LAIRAFAAIDCRGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MIETTLARGVGLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctaacgaccggcgtgatcggcgtgtccgcgttgccgtcgtgttcggcgggcgc
agcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctgcgcaacctggactcg
cggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcgtgggtgctcaccgac
gccaaccccgacgccctgacgatcaccaaccgggagcttcctcaggtcaaatcaggatcg
ggcaccgagctggcgctgccggccgatccgcggcgtggtggccagttggtgtcgctgccg
cccggggccggcgaggttctggagtcggtcgacgtggtgttcccggtactgcacggcccg
tacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctacgtgggc
gccggtgtgctggccagtgccgtcggcatggacaaggagttcaccaagaagctgctcgcc
gccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccgcggtcgacactgcac
cgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccgaggcggctcg
tcgatcggtgttagccgggtgtcgagttgggatcaactgcccgccgcggtcgcgcgggcc
cgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctggaatgc
ggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatccgggtg
gccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctcgacgac
gcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgattcgtcag
ctggcgatccgggcgttcgcggctatcgactgccggggtctggccagggtggacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgaccctgctggcgacg
atgatcgagacgacattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system