KEGG   Mycobacterium tuberculosis H37Rv: Rv2981cHelp
Entry
Rv2981c           CDS       T00015                                 

Gene name
ddlA
Definition
Probable D-alanine--D-alanine ligase DdlA (D-alanylalanine synthetase) (D-ala-D-ala ligase)
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:mtu00473]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mtu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3336796..3337917)
Genome map
AA seq 373 aa AA seqDB search
MSANDRRDRRVRVAVVFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTD
ANPDALTITNRELPQVKSGSGTELALPADPRRGGQLVSLPPGAGEVLESVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLH
RQECERLGLPVFVKPARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELEC
GVLEMPDGTLEASTLGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQ
LAIRAFAAIDCRGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MIETTLARGVGLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctaacgaccggcgtgatcggcgtgtccgcgttgccgtcgtgttcggcgggcgc
agcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctgcgcaacctggactcg
cggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcgtgggtgctcaccgac
gccaaccccgacgccctgacgatcaccaaccgggagcttcctcaggtcaaatcaggatcg
ggcaccgagctggcgctgccggccgatccgcggcgtggtggccagttggtgtcgctgccg
cccggggccggcgaggttctggagtcggtcgacgtggtgttcccggtactgcacggcccg
tacggcgaggacggcacgatccagggactgctcgaactcgccggggtgccctacgtgggc
gccggtgtgctggccagtgccgtcggcatggacaaggagttcaccaagaagctgctcgcc
gccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccgcggtcgacactgcac
cgccaggagtgcgaacggctgggcttaccggtgttcgtcaaacccgcccgaggcggctcg
tcgatcggtgttagccgggtgtcgagttgggatcaactgcccgccgcggtcgcgcgggcc
cgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggccgcgagctggaatgc
ggtgtgctcgaaatgccggacggcacactggaagccagcacgctgggggagatccgggtg
gccggggtgcggggacgcgaggactctttctacgacttcgcaaccaagtatctcgacgac
gcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgcagaggcgattcgtcag
ctggcgatccgggcgttcgcggctatcgactgccggggtctggccagggtggacttcttc
ctcaccgacgacggtccggtgatcaacgagatcaacacgatgccgggattcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggtgtcgactatccgaccctgctggcgacg
atgatcgagacgacattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system