KEGG   Mycobacterium tuberculosis H37Rv: Rv3144cHelp
Entry
Rv3144c           CDS       T00015                                 

Gene name
PPE52
Definition
(RefSeq) PPE family protein PPE52
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPE
Motif
Other DBs
NCBI-GeneID: 887930
NCBI-ProteinID: YP_177936
TubercuList: Rv3144c
UniProt: I6X6H8 A0A089QWX7
Position
complement(3510088..3511317)
Genome map
AA seq 409 aa AA seqDB search
MSFVVLPPEINSLRMFIGAGTAPMLAAAAAWDGLAEELGTAAQSFASVTAGLAGQAWQGP
AALAMAAAAAPYAGWLTAAAAQSAGAAGQARAVASIFEAAQAATVLPAAVAANRDAFVQL
VMTNLFGQNAPLIAAAEGVYEEMWAADVAAMSGYYSGASAIAAQVVPWASLLQRFPGLGA
GATGATGGESVGTGATGGESVGTGGGESVGTGGATASGGGVGYVGGGVASAGLAAGDPAH
GSVGQGNFGGGDVGAGDVVASSATSAHAGVVSPGFIGAPLALAALGQMARGGTNSAPGTA
TESARAPEPAASAPPEAVVEVPELEVPAMGVLPTVDPKVAAKAAPLSTTRVGQSAGSGIP
ESTLRTAQGQQASETSAAEETAPSLRPEAAAGQLRPRVRKDPKIQMRGG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttcgtcgtgctgccgccggagatcaattccttgcgaatgttcatcggtgcaggc
actgcgccgatgctggcggcggcggcagcctgggacgggcttgccgaagagttggggacc
gcggcgcaatcatttgcgtcggtcacggccgggctggcgggtcaggcgtggcagggtccg
gcagccttggcgatggcggcagcggcggctccctacgcggggtggttgaccgcggcagcg
gctcagtcggccggggcggcgggacaggcgcgcgcagtggccagcatcttcgaggcggcg
caggcggcgacggtgcttccggcggcggtggccgccaaccgcgacgcattcgtgcagctg
gtgatgacgaatttgttcgggcagaacgcgccgttgattgctgccgccgagggtgtgtac
gaggagatgtgggccgcggatgtggccgccatgtcggggtactactccggggcatcggcg
attgccgcgcaagtggtgccgtgggcgagtttgctgcagcgatttccgggtttgggtgcc
ggcgccaccggcgctactggcggtgagagcgtcggcaccggcgctactggcggcgagagc
gtcggcaccggcggcggtgagagcgtcggcaccggaggtgcaaccgctagcggcgggggc
gtcggctacgtcggaggcggcgtggctagcgccgggttagcggccggtgatccggcccat
ggcagtgtaggccaagggaatttcggcggtggcgatgttggcgccggagacgtcgtcgcg
tcgagcgctaccagtgcccatgccggcgttgtgagccccggcttcatcggtgccccgctc
gcgctcgccgctctgggtcagatggcacgtggcggcactaactctgccccgggaactgcc
accgagtcagctcgagcgccagagccggcggcttccgcgccaccggaagccgttgtggaa
gttccagaacttgaagttccagcaatgggggtgctgccaactgtggatccgaaagttgcg
gccaaggccgctccgctgtcgacaacgcgggtaggccaatccgcgggttctggaattccg
gaatcgacactacgcaccgcgcaaggtcagcaggcttcagagacttcagcggcggaggag
acagcgccgtcgttgcggccggaagcggcagcgggccaattacgacctcgggtaagaaag
gacccgaagattcaaatgcggggcggctga

DBGET integrated database retrieval system