KEGG   Mycobacterium tuberculosis H37Rv: Rv3148Help
Entry
Rv3148            CDS       T00015                                 

Gene name
nuoD
Definition
(RefSeq) NADH-quinone oxidoreductase subunit D
  KO
K00333  NADH-quinone oxidoreductase subunit D [EC:1.6.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv3148 (nuoD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Rv3148 (nuoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa
Motif
Other DBs
NCBI-GeneID: 888851
NCBI-ProteinID: NP_217664
TubercuList: Rv3148
UniProt: P9WJH5 I6YFE0
Position
3513338..3514660
Genome map
AA seq 440 aa AA seqDB search
MTAIADSAGGAGETVLVAGGQDWQQVVDAARSADPGERIVVNMGPQHPSTHGVLRLILEI
EGETVVEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMDYLSPFFNETAYCLGVEKLLGI
TDEIPERVNVIRVLMMELNRISSHLVALATGGMELGAMTPMFVGFRAREIVLTLFEKITG
LRMNSAYIRPGGVAQDLPPNAATEIAEALKQLRQPLREMGELLNENAIWKARTQGVGYLD
LTGCMALGITGPILRSTGLPHDLRKSEPYCGYQHYEFDVITDDSCDAYGRYMIRVKEMWE
SMKIVEQCLDKLRPGPTMISDRKLAWPADLQVGPDGLGNSPKHIAKIMGSSMEALIHHFK
LVTEGIRVPAGQVYVAVESPRGELGVHMVSDGGTRPYRVHYRDPSFTNLQSVAAMCEGGM
VADLIAAVASIDPVMGGVDR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaatcgccgactcggctggcggcgccggcgagaccgtcctggtcgctggcggg
caggactggcagcaggtcgtggacgccgcgcgcagcgcggatcccggtgaacgcatcgtc
gtcaacatggggccccagcacccgtctacccacggggtgttgcggttaatcctggagatc
gagggcgaaacagtcgtcgaagcccggtgcggaatcggctacctgcacaccggaatcgag
aagaacctcgaataccggtactggacccagggcgtcaccttcgtgacccgaatggattac
ctgtcaccgtttttcaacgaaaccgcctactgcctcggcgtggagaagctgctcggcatc
accgatgagatacccgagcgggtcaacgtcatccgcgtgctgatgatggagctcaaccgg
atctcgtcgcatttggtcgcattggcgaccgggggcatggaattgggcgccatgactccg
atgttcgtcggcttccgggcacgcgagatcgtgctcacgctgttcgaaaagatcaccggt
ttgcggatgaacagcgcctacatccgacccggcggcgtggcgcaggacttaccgcccaac
gcggccaccgaaatcgcggaagcactcaagcagttgcgccaaccactgcgcgaaatgggc
gagctgctcaacgaaaacgccatctggaaggcccgcacccagggcgtcggatacctggat
ctgaccggatgcatggcactgggcatcaccggcccgatactgcgttccactgggttgccc
cacgacctgcggaaaagcgagccctactgcggataccagcactatgaattcgatgtgatc
accgacgacagctgtgatgcctacgggcgctacatgattcgcgtcaaagagatgtgggag
tcgatgaagatcgtggagcagtgtctggacaagttacgacccggcccgaccatgatctcc
gatcgcaagctcgcctggccggccgacctgcaggtggggcccgacggcctgggcaactca
cccaagcacatcgccaaaatcatgggctcctcgatggaagcgctgatccaccacttcaaa
ctggtcaccgagggcatccgggtgccggcgggccaggtctacgtcgcggtggagtccccc
cgtggtgagctcggcgtacacatggtcagcgacggtggcacccgcccctaccgggtgcac
taccgggatccctccttcaccaacctgcagtccgtcgccgcgatgtgcgaaggcgggatg
gtcgccgatttgatcgcggcggtcgccagcattgacccggtcatgggcggggtggaccgg
tga

DBGET integrated database retrieval system