KEGG   Mycobacterium tuberculosis H37Rv: Rv3154Help
Entry
Rv3154            CDS       T00015                                 

Gene name
nuoJ
Definition
(RefSeq) NADH-quinone oxidoreductase subunit J
  KO
K00339  
NADH-quinone oxidoreductase subunit J [EC:1.6.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv3154 (nuoJ)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Rv3154 (nuoJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3521139..3521927
Genome map
AA seq 262 aa AA seqDB search
MTAVLASDVIVRTSTGEAVMFWVLSALALLGAVGVVLAVNAVYSAMFLAMTMIILAVFYM
AQDALFLGVVQVVVYTGAVMMLFLFVLMLIGVDSAESLKETLRGQRVAAVLTGVGFGVLL
ISTIGQVATRGFAGLTVANANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRE
RFERRKTQRELSQERFRPGGHPTPLPNPGVYARHNAVDVAALLPDGSYSELSVPRMLRTR
GADGLQTPSPGAVSGSLEGGAS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggtgctggcttcagatgtcatcgtccgcacctccaccggggaagcggtgatg
ttctgggtgctcagtgcgttggcgctgctgggcgcggtcggggttgtgctggccgtcaac
gccgtgtactcagcgatgtttctggcgatgaccatgatcatcctggcggtgttctacatg
gcccaggacgcgctgtttttgggtgtcgtccaggtggttgtctacaccggcgcggtgatg
atgctgttcctgttcgtgctgatgctgatcggtgtggactccgcggaatcactgaaggag
acgctgcgcgggcagcgggtcgccgcggtgctgaccggtgtcgggttcggcgttctcctg
atcagcaccatcggccaggtggcgacccgaggttttgccggactaaccgtcgccaacgcc
aacggcaacgtcgaaggcttggccgcgctgattttttcccgttacctgtgggcgttcgag
ttgaccagtgcgctgttgattaccgccgccgtcggggcgatggtgctagcgcaccgggag
cgtttcgagcgccgcaagacccagcgcgaactctcccaggaacgcttccgtcccggcggg
caccccaccccgctgcccaacccgggtgtctacgcgcgccacaacgcggtcgacgttgcc
gccctgctccccgacggttcctattccgaattgtcggtcccccggatgctgcgcacccgc
ggggccgacggcctgcaaacaccctcgcccggagccgtctccggctctttagaaggcggt
gcatcatga

DBGET integrated database retrieval system