KEGG   Mycobacterium tuberculosis H37Rv: Rv3159cHelp
Entry
Rv3159c           CDS       T00015                                 

Gene name
PPE53
Definition
(RefSeq) PPE family protein PPE53
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pentapeptide_2 PPE
Motif
Other DBs
NCBI-GeneID: 888794
NCBI-ProteinID: YP_177937
TubercuList: Rv3159c
UniProt: A0A089QWY8 Q6MX04
Position
complement(3527391..3529163)
Genome map
AA seq 590 aa AA seqDB search
MNYSVLPPEINSLRMFTGAGSAPMLAASVAWDRLAAELAVAASSFGSVTSGLAGQSWQGA
AAAAMAAAAAPYAGWLAAAAARAAGASAQAKAVASAFEAARAATVHPMLVAANRNAFVQL
VLSNLFGQNAPAIAAAEAMYEQMWAADVAAMVGYHGGASAAAAQLSSWSIGLQQALPAAP
SALAAAIGLGNIGVGNLGGGNTGDYNLGSGNSGNANVGSGNSGNANVGSGNDGATNLGSG
NIGNTNLGSGNVGNVNLGSGNRGFGNLGNGNFGSGNLGSGNTGSTNFGGGNLGSFNLGSG
NIGSSNIGFGNNGDNNLGLGNNGNNNIGFGLTGDNLVGIGALNSGIGNLGFGNSGNNNIG
FFNSGNNNVGFFNSGNNNFGFGNAGDINTGFGNAGDTNTGFGNAGFFNMGIGNAGNEDMG
VGNGGSFNVGVGNAGNQSVGFGNAGTLNVGFANAGSINTGFANSGSINTGGFDSGDRNTG
FGSSVDQSVSSSGFGNTGMNSSGFFNTGNVSAGYGNNGDVQSGINNTNSGGFNVGFYNSG
AGTVGIANSGLQTTGIANSGTLNTGVANTGDHSSGGFNQGSDQSGFFGQP
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaattattcggtgttgccgccggagattaattcgttgcggatgtttaccggtgcgggg
tctgcgccgatgcttgcggcatcggtggcttgggatcgtttggccgcggagttggcggtg
gcggcgtcctcgtttgggtcggtgacttcggggttggcgggtcagtcctggcagggtgcg
gcggcggcggcgatggccgcggcggcggcgccgtatgcggggtggttggctgctgcggcg
gcgcgggccgctggcgcgtcggctcaggccaaggcggtggccagtgcgtttgaggcggcg
cgggcggcgacggtgcatccgatgctggtggcggccaaccgtaatgcgtttgtgcagttg
gtgttgtcgaatctgtttgggcagaatgcgccggcgatcgcggccgctgaggcgatgtat
gaacagatgtgggccgccgatgtggccgcgatggtgggctatcacggcggggcatcggcg
gccgcggcgcagctgtcgtcgtggtcaattggtctgcagcaggcgttgccagctgcgcca
tcggcgctggccgccgcgatcggcctcggcaacatcggcgtcgggaacctgggcggcggg
aacaccggtgactacaatctgggcagcggaaattccggcaacgccaacgtaggtagcgga
aactccggcaacgccaatgtgggcagcggaaatgacggtgccacgaatttgggcagcgga
aatatcggcaacaccaatctcggcagcggaaacgttggcaatgtcaatctgggcagcgga
aaccgaggctttggaaacctcggcaacggaaactttggcagtgggaacctgggcagtgga
aacaccggaagtaccaacttcggcggcggaaatctcggttccttcaacttgggcagtgga
aacatcggctcctccaacatcggtttcggaaacaacggcgacaataacctcggcctcggg
aacaatggcaacaacaacatcggttttgggctcaccggcgacaacttggtgggcattggc
gcgctgaactcgggcatcgggaatctaggtttcgggaactcgggtaacaacaacatcggt
ttcttcaactctggcaacaacaacgtgggcttcttcaattcgggcaacaacaacttcggc
tttggaaacgcgggcgacatcaacacgggcttcggaaacgccggcgacaccaacacgggc
ttcggaaacgccggcttcttcaatatgggcatcgggaacgcgggcaacgaagacatgggc
gtcgggaacggcggttcctttaacgtgggcgttggcaatgcgggcaaccaaagtgtgggc
tttggcaacgcgggcaccctaaacgtgggcttcgcaaacgcgggcagtatcaatacggga
ttcgcgaactcgggcagcatcaatacgggcggtttcgactcgggcgaccggaacaccggg
tttggaagctcggtcgaccaatccgtttcgagctcgggcttcggcaacaccggcatgaat
tcctcaggcttctttaacacgggcaatgtttcggctggctatgggaacaacggtgacgtt
cagtcgggcatcaataacaccaactccggcggcttcaacgtcggcttctataactcgggt
gccggcaccgtgggcatcgcaaactctggcctgcagaccacaggcattgcgaactcgggc
accctcaacacgggtgtggcgaacacgggtgaccacagctcggggggcttcaatcagggc
agtgaccagtcgggcttcttcggtcagccctaa

DBGET integrated database retrieval system