KEGG   Mycobacterium tuberculosis H37Rv: Rv3160cHelp
Entry
Rv3160c           CDS       T00015                                 

Definition
(RefSeq) TetR family transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 HTH_5 DUF134 Cro
Motif
Other DBs
NCBI-GeneID: 888797
NCBI-ProteinID: NP_217676
TubercuList: Rv3160c
UniProt: A0A089SAC7 O53310
Position
complement(3529338..3529979)
Genome map
AA seq 213 aa AA seqDB search
MPRQAGRWSPTALRILGAAAELIALRGYSSTSTRDIAAAVGVEQPAIYKHFSAKRDILAA
LVRLAVEWPLELFGHITAMPVPAVVKLHRWLTESLDHLHASPYVLVSILITPDLHQESFV
AERELVAEMERALVGLIETGQGEGDVRAMHPLSAARLVQALFDALALPEFAVSPDEIVEF
AMTALLSDPDRLAEIRAAADALEIQTAPPDRGL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggcaggccggccgctggagcccaacggcactccgcatcctgggggccgctgcc
gagctcatcgcgctgcggggttacagctccacctcgacgcgagacattgccgcagccgtc
ggggtggagcagccggccatctacaaacacttctcggccaaacgcgatatccttgcggcc
ctggtgcggctcgccgtggagtggccgcttgagctgttcggtcacatcaccgcgatgccg
gttccggcggtggtcaagctgcaccgctggctgacggaatccctggaccacctgcatgct
tcgccctatgtgctggtttccatcctcatcaccccggacctgcatcaggaatccttcgtc
gcggagcgggagctagtcgcggagatggaacgcgcgctggttggcctgatcgagaccggc
caaggcgaaggtgatgtgcgcgcaatgcatccgttatcggctgccaggctggtgcaggcg
ttgtttgacgctctggcgctgccggaattcgcggtcagcccggacgagatcgtcgagttc
gcgatgacggcgctgttgtcggaccctgatcggctagccgagatccgggcagcagcagat
gctttggagatccagaccgcaccccccgaccgcgggctctag

DBGET integrated database retrieval system