KEGG   Mycobacterium tuberculosis H37Rv: Rv3166cHelp
Entry
Rv3166c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3534392..3535351)
Genome map
AA seq 319 aa AA seqDB search
MPGTKPGSDKPTGRVVVVIVLLMLAGAALRGHLPADDGAPLAAAGGSRAALMFIVAALAA
TLALIALAIITRLRHPLPVAPSAGELSAMLGGAAGRPNWRVLLLGLGTILAWLLIAILLA
RLFVPDDVGPAAPIPDSTATPDASSTTPSRPQPPQDNNDDVLGILFASTIGLFLMVVAGS
LITSRRQRKSAPARISGDRIESPAPSARSESLARAAEIGLAEMADLRREPREAIIACYVA
MERELSHVPGVAPQDFDTPTEVLARAVEHRALHGASAAALVSLFAEARFSPHVMNEEHRE
VAMRLLRLVLDELSTRTAI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtactaagcccggtagtgacaaaccgacagggcgcgtcgtcgtcgtgatcgtg
ctcttgatgcttgctggcgctgccctgcgcggccacctgccggccgacgacggtgcaccg
ctcgcggcggccggcggcagccgggcggcgctgatgttcattgtcgccgcacttgccgcg
acgctcgcgctgatagcgctcgccatcatcacccggttgcgacatccgctcccggtggcg
cccagcgcgggggagctctcggcaatgcttggcggtgcagcagggcgtccgaactggcgt
gtgctgttgctcggactcgggacaatcctggcctggctgctgattgcgatactgctggca
cggttgttcgtgcccgatgatgtcggtcctgctgcgcccataccggattcaaccgctacg
ccggatgcttccagcaccacgccgtcgcgcccgcaaccgccgcaagacaacaatgacgac
gtgctcggcattctctttgccagcacaatcggcctgttcttgatggtcgtcgcggggtcg
ctgattacctcgcgacgacagcgcaagtcggcaccggctcgtatcagtggcgatcgcatc
gagtctccggcgccctcggcgcgttcggaatcactggcgcgtgccgccgagatcggactg
gccgagatggccgacctccgccgcgaaccacgggaggcgataattgcgtgttacgtggcg
atggagcgtgaactgtcgcatgttcccggtgttgcccctcaggacttcgacaccccgacc
gaggtgctggcccgagccgtcgaacaccgtgcgctccatggtgctagtgccgccgcgttg
gtgagcctgttcgccgaggcgcgttttagcccgcacgtgatgaacgaggagcaccgtgag
gtggcgatgcgtttgcttcgactggttcttgacgaactgagcactcggaccgctatatga

DBGET integrated database retrieval system