KEGG   Mycobacterium tuberculosis H37Rv: Rv3169Help
Entry
Rv3169            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3537238..3538362
Genome map
AA seq 374 aa AA seqDB search
MPQMLGPLDEYPLHQLPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFLITGIGYYPNLGVK
DAFVLIRRADIQTAVHLSDAIDSDRLHQHVNGYRVEVVEPLRKLRIVLDETEGVAADLTW
EGLFDVVQEQPHVLRSGNRVTLDAQRFAQLGTWSGRIVVDGERIAVDPATWLGSRDRSWG
IRPVGEPEPAGRPADPPFEGMWWLYVPLAFDDFAVVLIIQEEPDGFRSLNDCTRIWRDGH
VEQLGWPRVRIHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWS
HGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVGRALCRDGDGNPVQGWGLFEHGALGR
HDPSGFADWSTLAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaatgctaggcccactcgacgagtacccgctacatcagcttccccagccgatc
gcctggccgggctcctccgaccgcaacttctacgaccgctcctacttcaacgcccacgac
cgcaccgggaacatctttctgatcaccggtatcggctactaccctaacctgggcgtgaaa
gacgcgttcgtgctgatcaggcgtgcggacatacagaccgcggtgcatctttcggatgcc
atcgactccgaccggctacaccagcacgtcaacggttaccgggtggaggtcgtcgagccg
ctgcgaaaactgcgtatcgtgctcgacgaaaccgaaggtgtggcggccgatctcacctgg
gagggcctgttcgacgtcgtccaggaacagccgcacgtcttgcgctccggcaaccgggtg
accctggatgcgcagcgcttcgcgcagctgggcacctggagcggccgcatcgtcgtcgac
ggcgaacggatcgccgtcgatccggcgacctggctcggcagccgggaccggtcctggggc
atccggccggtgggggaaccagaaccggcgggccggcccgccgacccacccttcgagggc
atgtggtggctgtatgtgccgttggccttcgacgacttcgccgtcgtgctgatcatccag
gaagaacccgacgggttccgctcgctcaacgactgcacccggatctggcgtgacggccac
gtcgagcagctgggctggccgcgggtgcggatccactaccgctccggcacccgcatcccg
accggggcgacgatcgaggcaagcacccccgacggcgcgccggtgcacttcgacgtggag
tccaaactggcggtgccgacccatgtcggtggcggctacgggggtgactcggactggtca
catggcatgtggaagggcgagaagttcgtcgagcgaagaacctacgacatgaccgatccg
acgatcatcgcgcgggccggcttcggcgtcatcgaccacgtcggtcgcgcgctatgccgc
gacggcgacgggaatccagtgcagggctggggtctgtttgaacacggggcgctgggccgc
cacgacccatcggggttcgccgactggtctacgctggcgccctag

DBGET integrated database retrieval system