KEGG   Mycobacterium tuberculosis H37Rv: Rv3170Help
Entry
Rv3170            CDS       T00015                                 

Gene name
aofH
Definition
(RefSeq) flavin-containing monoamine oxidase
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv3170 (aofH)
   00330 Arginine and proline metabolism
    Rv3170 (aofH)
   00340 Histidine metabolism
    Rv3170 (aofH)
   00350 Tyrosine metabolism
    Rv3170 (aofH)
   00360 Phenylalanine metabolism
    Rv3170 (aofH)
   00380 Tryptophan metabolism
    Rv3170 (aofH)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     Rv3170 (aofH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3538505..3539851
Genome map
AA seq 448 aa AA seqDB search
MTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGVPADMGG
SFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLIDIGRLR
WQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTWGCEPDD
VSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNAAVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRLSKAYAA
YSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGFDSLPIEERRRDAL
RCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGPIHWAST
ETADEWTGYFDGAVRSGQRAAAEVAALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccaccgtggactgtcgatgttgtcgtggtgggcgcgggcttcgccgggctg
gccgcggcccgcgagctgacgcgacagggtcacgaggtgctggtgttcgaaggccgcgat
cgggtgggcggccgctcgttaaccggtcgcgtggcaggggtgcccgcggatatgggcggc
tcgttcatcggcccgacccaagacgccgtgctggcgttggccaccgagctggggatcccg
acaaccccgacccaccgcgacggccgaaacgtcatccagtggcggggatcggcacgcagc
tatcgtggcaccatccccaagctgtcgctgaccgggctcatcgacatcggccggttgcgt
tggcaattcgagcgaattgcccgcggcgttccggtggccgccccctgggatgcgcggcgc
gcgcgtgaactcgacgacgtgtcgctcggggagtggttgcgcttggtgcgcgccacatcg
tcctcgcggaacctgatggccatcatgacccgggtgacctggggttgtgagcccgacgat
gtctcgatgctgcacgccgcccgctacgtacgcgcggccggcggcctggaccggctgctc
gacgtcaaaaatggtgcccagcaggaccgtgtgccgggggggacacagcagatcgcccag
gcggccgccgcccaactcggcgcacgcgtcctgctcaacgccgcggtgcgtcgcatcgac
cggcacggagcgggtgtgacggtcacgtccgatcagggtcaggccgaggccgggttcgtc
atcgtcgccattccaccggcccatcgcgtggccatcgagttcgatcccccgctgccgccg
gaatatcagcagctcgcccaccattggccgcagggccggctgagcaaggcctacgcggcc
tattcgacgccgttctggcgggccagcgggtattccggccaggcgctgtccgatgaggcg
ccggtgttcatcaccttcgacgtcagtccgcacgccgacgggccaggcattctgatgggg
ttcgtcgatgctcgcgggttcgactcgctacccatcgaagagcgccgccgcgatgcattg
cgctgctttgcgtcgctgttcggcgacgaagcgctcgacccccttgattatgttgactat
cgttggggtacagaggaattcgcgccgggtggtccgaccgcggcggtaccgccggggtcg
tggacgaaatacggtcactggttacgtgagccggtcggtccgattcactgggcgagcact
gagaccgcggacgaatggaccgggtatttcgacggcgccgtcagatccggtcagcgtgcc
gccgccgaggtcgccgccctgctatga

DBGET integrated database retrieval system