KEGG   Mycobacterium tuberculosis H37Rv: Rv3172cHelp
Entry
Rv3172c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4440
Motif
Other DBs
NCBI-GeneID: 888848
NCBI-ProteinID: NP_217688
TubercuList: Rv3172c
UniProt: O53322
Position
complement(3540882..3541364)
Genome map
AA seq 160 aa AA seqDB search
MSVALLREMFDRMVVAKNAELIEHYYDPDFLMYSDGLSQSFAKFRDSHRKLYATAISYAV
EYDEHAWVEAQTRLPGGCGSPRRDLARSRPASRWYSLPPTATAEFTGSGRRRGRVGATWP
PSTITETTTDRLAMRNQLRAGAATLLFCDPMLQRFPATRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgcgctgcttcgggaaatgttcgatcggatggtcgtcgccaaaaacgcggag
ctgatcgagcactactacgacccagacttcctgatgtactccgacgggctgagccagagc
ttcgcaaaattccgcgatagccaccgcaagctctacgccacggcgatcagctacgcggtc
gaatacgacgagcacgcatgggtagaggcccagacaaggttgccgggcgggtgtggatca
ccacgtcgcgacctggcgaggagccgacccgcatcgaggtggtactcattgccgcctacc
gcaacggccgaattcaccggatctgggagacgacgtggccgagttggcgcaacgtggccg
ccctcgacgattactgagacgactactgatcggctggcgatgcgaaaccagctgagagca
ggggccgcgacgttattattctgtgatcctatgcttcagcgatttccagctacccgtaag
taa

DBGET integrated database retrieval system