KEGG   Mycobacterium tuberculosis H37Rv: Rv3174Help
Entry
Rv3174            CDS       T00015                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 NAD_binding_10 KR Epimerase RmlD_sub_bind HTH_38
Motif
Other DBs
NCBI-GeneID: 887989
NCBI-ProteinID: NP_217690
TubercuList: Rv3174
UniProt: O53324 L0TEI1
Position
3542138..3542845
Genome map
AA seq 235 aa AA seqDB search
MTSLAERTVLVTGANRGMGREYVAQLLGRKVAKVYAATRNPLAIDVSDPRVIPLQLDVTD
AVSVAEAADLATDVGILINNAGISRASSVLDKDTSALRGELETNLFGPLALASAFADRIA
ERSGAIVNVSSVLAWLPLGMSYGVSKAAMWSATESMRIELAPRGVQVVGVYVGLVDTDMG
RFADAPKSDPADVVRQVLDGIEAGKEDVLADEMSRQVRASLNVPARERIARLMGN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactagccgagcggaccgtgctcgtcaccggcgccaaccgcggcatgggccgc
gaatacgtcgctcagcttctcggtcgcaaagtggcaaaggtctatgccgctacccgcaac
ccgctggcaatcgacgttagcgatccgcgcgtgattccgctccaactcgacgtcaccgac
gcggtgtcggtcgccgaggcagccgacttagcaaccgatgtcggcattctgatcaacaat
gccggcatctcccgggcgtcctcggtgctcgacaaggacacatccgcgcttcgcggcgag
ctggagacgaacctgttcggaccgctcgcgctggcctccgcgttcgccgaccgcatcgcc
gagagatccggtgccatcgtcaacgtttcctcggtactcgcctggcttccccttggcatg
agctatggagtgtccaaggcggcgatgtggagcgcgacggagtcgatgcgtatcgagctg
gcgccgcgcggtgtgcaggtggtgggcgtctacgtggggctggtcgacaccgacatgggt
cgattcgccgacgcgccgaagtccgatcctgccgatgtggtccgccaggtgctcgacgga
atagaggctggcaaggaggacgtgctggccgacgagatgagccgtcaggtgcgcgcgtcg
ctgaatgtccctgcgcgggaacgtatcgcgcggttgatgggtaactga

DBGET integrated database retrieval system