KEGG   Mycobacterium tuberculosis H37Rv: Rv3174Help
Entry
Rv3174            CDS       T00015                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3542138..3542845
Genome map
AA seq 235 aa AA seqDB search
MTSLAERTVLVTGANRGMGREYVAQLLGRKVAKVYAATRNPLAIDVSDPRVIPLQLDVTD
AVSVAEAADLATDVGILINNAGISRASSVLDKDTSALRGELETNLFGPLALASAFADRIA
ERSGAIVNVSSVLAWLPLGMSYGVSKAAMWSATESMRIELAPRGVQVVGVYVGLVDTDMG
RFADAPKSDPADVVRQVLDGIEAGKEDVLADEMSRQVRASLNVPARERIARLMGN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactagccgagcggaccgtgctcgtcaccggcgccaaccgcggcatgggccgc
gaatacgtcgctcagcttctcggtcgcaaagtggcaaaggtctatgccgctacccgcaac
ccgctggcaatcgacgttagcgatccgcgcgtgattccgctccaactcgacgtcaccgac
gcggtgtcggtcgccgaggcagccgacttagcaaccgatgtcggcattctgatcaacaat
gccggcatctcccgggcgtcctcggtgctcgacaaggacacatccgcgcttcgcggcgag
ctggagacgaacctgttcggaccgctcgcgctggcctccgcgttcgccgaccgcatcgcc
gagagatccggtgccatcgtcaacgtttcctcggtactcgcctggcttccccttggcatg
agctatggagtgtccaaggcggcgatgtggagcgcgacggagtcgatgcgtatcgagctg
gcgccgcgcggtgtgcaggtggtgggcgtctacgtggggctggtcgacaccgacatgggt
cgattcgccgacgcgccgaagtccgatcctgccgatgtggtccgccaggtgctcgacgga
atagaggctggcaaggaggacgtgctggccgacgagatgagccgtcaggtgcgcgcgtcg
ctgaatgtccctgcgcgggaacgtatcgcgcggttgatgggtaactga

DBGET integrated database retrieval system