KEGG   Mycobacterium tuberculosis H37Rv: Rv3175Help
Entry
Rv3175            CDS       T00015                                 

Definition
(RefSeq) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00330  Arginine and proline metabolism
mtu00360  Phenylalanine metabolism
mtu00380  Tryptophan metabolism
mtu00627  Aminobenzoate degradation
mtu00643  Styrene degradation
mtu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv3175
   00360 Phenylalanine metabolism
    Rv3175
   00380 Tryptophan metabolism
    Rv3175
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rv3175
   00643 Styrene degradation
    Rv3175
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Rv3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 887294
NCBI-ProteinID: NP_217691
TubercuList: Rv3175
UniProt: O53325 A0A089SAD6
Position
3542860..3544347
Genome map
AA seq 495 aa AA seqDB search
MAMSAKASDDIAWLPATAQLAVLAAKKVSSAELVELYLSRIDTYNASLNAIVTVDPDAAR
RVAKRSDAARARGDELGPLHGLPITVKDSYETAGMRTTCGRRDLADYVPTQDAEAVARLR
RAGAIIMGKTNMPTGNQDVQASNPVFGRTNNPWDAARTSGGSAGGGAAATAAGLTSFDYG
SEIGGSTRIPAHYCGLYGHKSTWRSVPLVGHIPSAPGNPGRWGQADMACAGVQVRGARDI
IPALEATVGPMRADGGFSYALAPPRAGALKDFRVAVWAEDPHCPIDADVRRAMDDAVAAL
RAAGAHVVEQPATIPVDMAVSHNIFQSLVFGAFAVDRSTLSPASAAALGLRAVRHPRGEA
ANALGATLQSHRAWLFADAARHEMRDRWAGFFNEFDVLLLPVTPTPAPLHHNKDHDRLGR
TIDVDGVSRSYWDQLKWNALANIAGTPATTMPITTTATGLPIGIQAMGPAGGDRTTVEFA
ALLTEVLGGFRVPPL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtccgccaaggcctcagacgatattgcctggctaccggcgaccgctcaactc
gcggtgctcgccgccaagaaggtgtccagcgcggagttagtcgagctgtatctttcccga
atcgacacgtacaacgcgtcgctcaacgcgatcgtcaccgttgaccccgacgccgcccga
cgcgtcgccaagcggtccgatgcggcacgagcccgcggcgacgaactcggcccgttgcat
gggttgccgatcaccgtcaaggacagctatgagacggccggcatgcgcacgacctgcggt
cgccgcgaccttgccgactatgtacccacccaggacgccgaggcggtcgcccggttgcgc
cgggccggcgcgatcatcatgggcaagacaaacatgcccaccggcaaccaggacgtccag
gccagcaatccggtcttcggccgcaccaacaacccatgggacgccgcgcgcacgtccggc
ggctcggccggcggcggggcggccgccaccgcggccgggctgaccagcttcgactacggc
tcggagatcggcggctctaccaggatcccggctcattactgcggtctgtacggccacaaa
tcgacctggcgctcggttcctctggtcgggcacattcccagcgcaccaggtaatcccggg
cgatgggggcaagccgacatggcctgcgcgggcgtgcaggtgcgcggtgcccgcgacatc
atccccgcactggaggcgaccgtcgggccgatgcgggcggacggaggattctcgtatgcg
ctcgctccgccacgagccggcgcgctcaaagacttccgggtcgcggtctgggccgaggac
ccgcattgcccaattgacgccgacgtgcgtcgggccatggatgatgctgtcgccgcgctg
cgcgccgcgggcgcacacgtcgttgagcagcccgccaccatcccggtcgatatggcggtg
tcgcacaacatcttccagagtctggtgttcggcgccttcgctgtcgaccggtccaccctc
agcccagcctccgccgccgcgctcggattacgcgcggttcggcatcctcggggcgaagcc
gccaacgccctgggtgcgacgctacagagccaccgtgcgtggttgttcgccgatgcggcg
cgccacgaaatgcgcgaccggtgggccggattcttcaacgagttcgacgtgctgctcctg
cccgtcacgcccacccccgcgccgctccaccacaacaaggaccacgaccggttgggccgc
accatcgacgtcgacggcgtctcacgatcgtactgggaccaactcaaatggaacgcgctg
gccaacatcgccggcaccccggccaccaccatgcccatcaccaccacagctaccggactc
ccgatcggcatccaggcgatggggcccgcgggcggagaccgcaccaccgtagagttcgcc
gccctgctcaccgaagtcctaggcggcttccgcgttccccctctttag

DBGET integrated database retrieval system