KEGG   Mycobacterium tuberculosis H37Rv: Rv3178aHelp
Entry
Rv3178a           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3547037..3547330
Genome map
AA seq 97 aa AA seqDB search
MTAAEDKEERLRLSGTRIELEELLQLPVDVAYEGLLTDDVSESVRKKLITLRAGPSRTAC
SNLRNPAGVGADDGARRDVVHQRDIADGTGVEPATHR
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcggccgaggacaaagaagagcggcttcggctgtccggaacccggatcgaactc
gaggagctacttcagcttccggtcgatgttgcgtacgagggcctgttgacggacgacgtt
tccgaatccgttcgcaaaaagctcattacgctacgagccggtccctcaagaaccgcctgc
tcgaatctgcgcaaccccgctggcgttggggcggacgacggtgctcggcgtgatgtggtg
caccaaagggacattgccgacggaactggcgttgagccagcaacacaccgttga

DBGET integrated database retrieval system