KEGG   Mycobacterium tuberculosis H37Rv: Rv3179Help
Entry
Rv3179            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K07133  uncharacterized protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4143 AAA_14 AAA_16 AAA_33 DUF746 ATPase_2 AAA_35 Sigma54_activat TsaE Put_DNA-bind_N SRPRB
Motif
Other DBs
NCBI-GeneID: 887947
NCBI-ProteinID: NP_217695
TubercuList: Rv3179
UniProt: A0A089SAE1 O53329
Position
3547618..3548907
Genome map
AA seq 429 aa AA seqDB search
MVHDEAGHELIERHMLEQLREVAEYTRVVLINGPRQAGKTTLLQQLHAELGGWLRSLDVD
VERASARADPEGYIMSAPRPTFLDEVQCAGDPLILAIKTATDRDRRPRQFFLSGSTRFLT
VPTLSESLAGRVAILDLWPLSVAERSGVRPEIIAQLFTEPQVVLGTEPAPVTRHEYLQLA
CAGGFPEVVQRPAGRARSRWFSDYLRTVTQRDVRELKRIEQTDRLPRFMRYLAAITAQEL
NVAEAARVIGVDAGTIRSDLALFETVYLVHRLPAWSRNLTAKIKKRSKIHVVDSGFAAWL
RGQSADSLARPTAEGAGPIMETFVINELMKLRAATELEVDLYHFRDRDGREIDCILQTPD
SRVVGVEVKASATVNVHDFRHLSFARDRLGDEFITGVLFYTGARALPFGDRLMALPINLL
WNGQSVSSL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcatgatgaggctggtcacgagctgatcgagcggcacatgctcgaacagttgcgc
gaggttgcggagtacacccgtgtcgtgctgatcaatggtccacggcaggctggtaagacg
acgctgctccaacaattgcacgccgagctaggcggatggctgcgttcgttggatgttgac
gtcgaacgcgcgtcggcgcgagccgatcccgaggggtacatcatgtccgcgccgcgcccg
acgttcttggacgaggtccagtgcgccggggatccgttgatcctggcgatcaagacggca
accgatcgtgaccgccggcccagacagttcttcctgtcggggtcgacccgattcctgacg
gtgccgacgctgtcggaatcactggccggacgggttgcgatcctcgacctctggccgctg
tctgtcgctgaacgatcgggtgtccggccggagatcattgcgcaactgttcactgaaccc
caagtggtcctgggcacggagcccgccccggtcacgcgacatgagtatctgcagctggcc
tgcgcgggtggctttccggaagttgtgcagcgcccggcgggtcgcgcccgcagccggtgg
ttctcggactatctgcgcacggtgacgcagcgcgacgtgcgcgagctgaagcggatcgag
cagacggatcgcctgccgcggttcatgcgctacctggccgctatcaccgcgcaggagctg
aacgtggccgaagcggcgcgggtcatcggggtcgacgcggggacgatccgttcggatctg
gcgttgttcgagacggtctatctggtacatcgcctgcccgcctggtcgcggaatctgacc
gcgaagatcaagaagcggtcaaagatccacgtcgtcgacagtggcttcgcggcctggttg
cgcgggcaaagcgccgactccctggccaggccaaccgcggagggcgcgggcccgatcatg
gaaacgttcgtgatcaacgagctgatgaagctacgtgcggcgaccgaactcgaggttgac
ctgtatcactttcgcgatcgagacggacgggagatcgactgcattcttcagaccccagac
agtcgcgtcgtcggtgtcgaggtcaaagcctcggcgacagtgaacgtccatgatttccga
cacttgtcattcgcgcgtgaccgactcggcgacgaattcatcaccggagttctcttctac
actggtgcccgggctttgccgttcggcgaccggttgatggctctacccatcaatctcctc
tggaacggacaatccgtctccagcctgtag

DBGET integrated database retrieval system