KEGG   Mycobacterium tuberculosis H37Rv: Rv3190cHelp
Entry
Rv3190c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3555422..3556687)
Genome map
AA seq 421 aa AA seqDB search
MEYVQLFSKGRLNDLAGSLAGFLGKASQATAQRLQSWDADDLLNTPVDDVVEQLVELGSV
ECPDLRVDDAFMLPATEVDQQYRDWGEQRTRRVTRLVLVVPFEGHKDIFNLRPDQFTTMP
PQVLRLQGHEIHLAIDNLSNDAAAINAAFHKQIANIEKYLGWSRRQIDLHNQGLRNELPG
MVARRREQLLATRNLQAEIGFPVRRRKDADTYAAPISRKSVRPRPHRPAGARAAFKPEPA
MQDEDYQSALRVLRNQRNALERTPSVAAKLDGEEIRDMLLVGLNAQFEGDAGGELFNGAG
KTDILIRVDDRNIFIGECKVWSGPRTMDDVLKQLFGYLVWRDTKAAILLFIRNKDVTAVI
DNAIAKIKEHPNHKRCPAHRAGADQYEFTMHADGDPEREIHLTLIPFALRPTAEVPTTTI
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggagtatgttcagctgttttccaaggggcgcctcaacgatctcgctggctccttagcc
ggatttctcggaaaggcgagccaagccacggcgcagcgtcttcagagctgggacgccgac
gacctgctgaacacgcccgttgatgacgtcgtcgaacagctcgtcgaattgggttcggtc
gaatgccccgatctgcgcgtcgacgacgctttcatgctgccagccaccgaggtcgaccag
cagtaccgggattggggcgaacagcgcacccgacgcgtgacgaggctcgttctcgtggtg
cccttcgaggggcataaggacatctttaaccttcgcccggaccagttcacgaccatgccg
ccgcaggtactgcggctacaaggtcacgaaatccacctggcgatcgacaatctgtcgaat
gacgccgcggcgatcaacgcggcgtttcataagcagatcgcgaatattgagaagtacctc
ggttggtcgcgccggcagatcgacttgcacaaccaaggactgcgcaacgagctaccgggc
atggtggcgaggcgccgtgagcagctcttagcgacccgaaacctccaggccgagatcggc
ttccctgtacgccgcaggaaggacgccgacacatacgcagctccgatcagtcggaaaagc
gtgcgtccgcggccacaccgcccagcgggcgcgagggcagcattcaagccggagcctgca
atgcaggatgaggactaccagtccgcacttcgggtgctccgtaaccagcggaacgcgttg
gagcgcaccccatctgtcgccgccaagctcgacggggaagaaatccgagacatgctgctc
gtcggcctcaacgcacagtttgaaggcgatgccgggggcgaactcttcaacggcgcaggc
aagaccgacattctcattcgcgtcgacgaccgcaacatcttcattggcgaatgcaaagtg
tggtcgggcccaagaaccatggacgatgtgctgaagcagctattcggctaccttgtgtgg
cgcgacaccaaggccgcgatcttgctctttatccgcaacaaagacgtgaccgcggtcatc
gataacgccatcgccaagatcaaagagcacccgaatcataagcgctgccccgcacatcgg
gccggtgcagaccagtacgagttcaccatgcacgccgacggtgatcccgaacgcgagatt
cacctgacattgattccctttgcattacgcccgacagcagaggtgccaacgacgaccatt
ccgtga

DBGET integrated database retrieval system