KEGG   Mycobacterium tuberculosis H37Rv: Rv3194cHelp
Entry
Rv3194c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K07177  
Lon-like protease
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rv3194c
Peptidases [BR:mtu01002]
 Serine Peptidases
  Family S16: lon protease family
   Rv3194c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3563264..3564286)
Genome map
AA seq 340 aa AA seqDB search
MNRRILTLMVALVPIVVFGVLLAVVTVPFVALGPGPTFDTLGEIDGKQVVQIVGTQTYPT
SGHLNMTTVSQRDGLTLGEALALWLSGQEQLMPRDLVYPPGKSREEIENDNAADFKRSEA
AAEYAALGYLKYPKAVTVASVMDPGPSVDKLQAGDAIDAVDGTPVGNLDQFTALLKNTKP
GQEVTIDFRRKNEPPGIAQITLGKNKDRDQGVLGIEVVDAPWAPFAVDFHLANVGGPSAG
LMFSLAVVDKLTSGHLVGSTFVAGTGTIAVDGKVGQIGGITHKMAAARAAGATVFLVPAK
NCYEASSDSPPGLKLVKVETLSQAVDALHAMTSGSPTPSC
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaataggcggatattgaccttgatggtcgcgctggtgccgatcgtggtattcggcgtg
ttgctcgccgtggtaaccgtgccgtttgtggcgctgggacccggcccaacgttcgacacg
ctcggcgagatagacggcaagcaggtggtccagatcgtgggcacccagacctacccgacg
tcaggtcacctcaacatgacgacggtctcccagcgcgacggtctaaccctgggtgaagcc
ctggccctgtggctttcgggtcaagaacagttgatgccacgcgacctcgtctaccctccg
ggcaagtcgcgggaagagatcgaaaatgacaacgccgctgatttcaagcgctccgaggcc
gccgctgagtacgccgctctggggtacctgaagtatccgaaagcagtcaccgtcgcctcg
gtcatggatccagggccatcggtggacaagctgcaggccggtgacgccatcgacgccgtc
gacggcactccggtgggcaacctcgaccagttcaccgcgctgttgaagaacacgaaaccg
ggccaggaggtgacgatcgacttccgccgcaagaacgagccgcccggcatcgcgcagatc
acgctgggcaagaataaggatcgcgaccaaggcgtcctgggcatagaggtggtggacgcg
ccgtgggcgccgtttgccgtggacttccacctcgccaacgtcggcggcccttcggccgga
ctgatgttcagtctggccgtcgtcgacaagctcaccagtggccacctggttgggtcgacg
ttcgtcgcaggcaccggcacgatcgccgtcgatggcaaggtgggccagatcggtggcatc
acccacaagatggccgctgctcgagcggccggcgcgacggtgtttctggtgcccgcgaag
aactgctacgaggcaagttccgacagcccgcccggtttgaagttggtgaaggtcgagacg
cttagccaggcggtggacgcgctgcacgcgatgacgtcgggctcgccgacgccgagctgc
tag

DBGET integrated database retrieval system