KEGG   Mycobacterium tuberculosis H37Rv: Rv3196Help
Entry
Rv3196            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3565788..3566687
Genome map
AA seq 299 aa AA seqDB search
MSARSVAPSQVMRRAASALYSLNPAMPVLLRPDGAVQVGWDPRRAVLVRPPRGLTATGLA
ALLRSMRSPIPITELQRQAAERGLVDGDAMANLVAQLVGAGVATPLANPGNLDSRRRAAS
IRVHGRGPLSDLLVQALRCSGARIRHSSQPHAAVTPAGVDLVVLSDYLVADPHMVRDLHT
ERVPHLPVRVRDGTGMVGPLVVPGVTSCLGCADLHRSDRDAAWPAIAAQLRDTVGVADRA
TLLATAALALSQVNRVIAAVRGQEATPEPPSALNTTLEFDLNAGSIVARQWTRHPRCFC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgctcgcagtgtggcaccgtctcaggtcatgcggcgggctgcgtctgctctgtat
tcgttgaatcctgcgatgccggtgctgctaagacccgacggtgccgtgcaagtgggctgg
gatcctcgtcgggctgtgctcgtccgtccaccgcgtggattaaccgcgacaggtttggcc
gcgctgctgcggtccatgcgatcaccgataccaatcaccgagttgcagcgccaagccgcc
gagcgtggattggttgacggtgacgccatggcgaaccttgtcgcgcaactggttggcgcg
ggtgtagcgacccccctagccaaccccggaaacctggattcccggcgtcgcgccgcgtcc
atccgggtccacggtcgcgggccgttgtcagacctgctcgtccaggcgctgcgctgctcc
ggtgcccggatcaggcacagcagccaaccacatgcggcggtgactcccgcgggcgtggat
ctggtggtgttgtcggactatctggtggccgatccgcacatggtgcgcgatctgcacacc
gagagagttccgcatcttcccgttcgggttcgtgacggcaccgggatggtcgggcccctg
gtggtccccggcgtgaccagctgtctcggttgcgctgacctgcatcgcagcgaccgcgac
gccgcgtggccggccatcgccgcccaattgcgggacaccgtcggggtggccgaccgggcc
acgttgttagcgacggcggcgctggcgctcagccaagtgaaccgggtgatcgccgccgtg
cgtggacaggaggcgacccctgagcccccgtcggcgctgaacaccaccttggagttcgat
ctcaacgctggctctatcgtggcgcgacaatggaccaggcatccgcggtgtttttgttga

DBGET integrated database retrieval system