KEGG   Mycobacterium tuberculosis H37Rv: Rv3197AHelp
Entry
Rv3197A           CDS       T00015                                 

Gene name
whiB7
Definition
(RefSeq) transcriptional regulator WhiB7
  KO
K18958  
WhiB family transcriptional regulator, redox-sensing transcriptional regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Transcription factors [BR:mtu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Rv3197A (whiB7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3568401..3568679)
Genome map
AA seq 92 aa AA seqDB search
MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRA
EPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtactgacagtccccagacagacccccagacaaagattgccggttttgccgtgc
cacgtcggtgatcccgatctgtggttcgccgataccccggccggtctcgaggtagccaag
acactgtgtgtgagctgcccgatcaggcggcagtgcttggccgcggcgcttcagcgggct
gaaccctggggcgtttggggtggtgagatattcgaccaaggctcgatcgtgagtcacaag
cgtccgcgcggacgtccgcgcaaggatgctgttgcatag

DBGET integrated database retrieval system