KEGG   Mycobacterium tuberculosis H37Rv: Rv3198cHelp
Entry
Rv3198c           CDS       T00015                                 

Gene name
uvrD2
Definition
(RefSeq) ATP-dependent DNA helicase UvrD
  KO
K03657  
DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Rv3198c (uvrD2)
   03430 Mismatch repair
    Rv3198c (uvrD2)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rv3198c (uvrD2)
DNA repair and recombination proteins [BR:mtu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Rv3198c (uvrD2)
   MMR (mismatch exicision repair)
    Other MMR factors
     Rv3198c (uvrD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(3569109..3571211)
Genome map
AA seq 700 aa AA seqDB search
MSIASDPLIAGLDDQQREAVLAPRGPVCVLAGAGTGKTRTITHRIASLVASGHVAAGQVL
AVTFTQRAAGEMRSRLRALDAAARTGSGVGAVQALTFHAAAYRQLRYFWSRVIADTGWQL
LDSKFAVVARAASRTRLHASTDDVRDLAGEIEWAKASLIGPEEYVTAVAAARRDPPLDAA
QIAAVYSEYEALKARGDGVTLLDFDDLLLHTAAAIENDAAVAEEFQDRYRCFVVDEYQDV
TPLQQRVLSAWLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDAAVVRLERDYRS
TPQVVSLANRVIAAARGRVAGSKLRLSGQREPGPVPSFHEHSDEPAEAATVAASIARLIA
SGTPPSEVAILYRVNAQSEVYEEALTQAGIAYQVRGGEGFFNRQEIKQALLALQRVSERD
TDAALSDVVRAVLAPLGLTAQPPVGTRARERWEALTALAELVDDELAQRPALQLPGLLAE
LRRRAEARHPPVVQGVTLASLHAAKGLEWDAVFLVGLADGTLPISHALAHGPNSEPVEEE
RRLLYVGITRARVHLALSWALSRSPGGRQSRKPSRFLNGIAPQTRADPVPGTSRRNRGAA
ARCRICNNELNTSAAVMLRRCETCAADVDEELLLQLKSWRLSTAKEQNVPAYVVFTDNTL
IAIAELLPTDDAALIAIPGIGARKLEQYGSDVLQLVRGRT
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatagccagcgacccattgattgccgggctggacgaccagcagcgcgaagccgta
ctggctccgcgtggaccggtgtgcgtgctggccggtgccggaaccggcaagacccgcacc
atcactcaccggatcgcttcgctggtcgcgagcggtcacgtcgccgccgggcaggtgctg
gctgtgacattcacccagcgcgcggcgggcgaaatgcgcagccggttgcgcgcactcgac
gccgcggcacggaccggttcgggcgtcggcgctgtgcaggcgctgacctttcacgcggcc
gcgtatcgccagctgcggtacttctggtcgcgcgtaatcgctgacaccggctggcagctg
ctggacagcaagttcgccgtggtggcccgcgccgccagccgcaccaggctgcacgccagc
accgatgatgtgcgtgacctggccggcgagatcgagtgggccaaggcgtccctgatcggc
cccgaggagtatgtgaccgcagtggcggccgcacgccgagaccccccgttggacgccgcg
caaatcgcggctgtctactccgaatacgaggcgctcaaggcccgcggcgacggcgtcacc
ttacttgacttcgacgacctgttgctgcacaccgcggccgcgattgaaaacgacgccgcg
gtggccgaggagttccaggaccggtaccggtgtttcgtcgtggacgagtaccaggacgtc
acccccctgcagcagcgggtgctctcggcctggttgggtgatcgggacgacctgaccgtc
gtcggcgacgccaaccagaccatctactcgtttaccggggcttcgcctcgtttcctactc
gacttctcgcggcggttcccggacgccgcggtggtgcggctggagcgtgattaccggtca
actccgcaggtggtgtcattggctaaccgggtgatcgccgccgcccggggccgtgttgcc
ggcagcaagctacggttgtccggccagcgtgagccgggtccggtcccgtcgttccatgag
cattccgacgagcccgccgaggctgccacggtggcggcgtcaatcgcccggttaatcgca
tcgggcactccgccatccgaggtagccattctctaccgagtcaatgcgcagtcagaggtt
tatgaagaggcgttgacccaggcgggtatcgcctatcaggttcgcggtggcgaggggttt
ttcaaccgtcaggaaatcaagcaggcgttgcttgccttacagcgtgtgtccgaacgtgat
accgatgccgcgttgtccgacgtggttcgcgcggtgctcgcaccactggggctgacggca
caaccgccggtcggcacccgcgccagggaacgctgggaagcgctcaccgcgctggccgag
ctggtcgacgacgagctggcgcagcgtcccgcactgcagctgccaggcctgcttgccgag
ctacgccggcgggcggaggcgcggcacccaccggtggtgcagggcgtcacgctggcctca
ctgcacgccgccaagggactggaatgggacgcggtgttcctggtcggattggctgacggc
acgctgcccatctcacatgcgctggcacacggccccaatagcgagcccgtagaggaagag
cgtcggctgctctacgtcggaatcacacgggcccgagtccatttggcgctcagctgggcg
ctatcacggtccccgggcgggcgccagagccgcaagccctcgcggttcctcaacggcatt
gcgccgcagacgcgcgccgatccggtgccgggcacatcccgacgcaaccggggcgccgca
gcgcgctgccggatctgtaacaacgagctgaacacttcggcggccgtcatgctgcggcgg
tgtgagacgtgtgcagccgacgtcgacgaggagttgttgttgcagctcaagtcctggcgt
ctgagcaccgccaaggaacagaacgtccccgcctatgtcgttttcaccgacaacaccctg
atcgcgatcgccgagctgctacctaccgacgacgcggcgctgatcgcgatccccggcatc
ggtgcccgcaagctggaacaatacggatcggacgtgctgcagctggttcgcggtcggacc
tga

DBGET integrated database retrieval system