KEGG   Mycobacterium tuberculosis H37Rv: Rv3209Help
Entry
Rv3209            CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
3586274..3586834
Genome map
AA seq 186 aa AA seqDB search
MALGAVATAVIINSGDSTSTKAIVGAPAPRTVISTSPRPTAPTSTSPHPSPSTLRPQLPP
ETVTTVAPPGTGPTTVPTRTPTAAPPQTAVPPPAPLNPRTVVYRVTGTKQLFDLVNVVYT
DARGFPVTDFNVSLPWTKMVVLNPGVQTESVVATSLYSRLNCSIVNTGAQTVVASTNNAI
IATCTR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcttggcgcggtcgcgaccgcagtcattatcaacagcggagatagcacgtcgacc
aaggccattgtcggggcaccagccccgcgcacggtgatatccacctcgccacgaccaacg
gccccgaccagcacgtcaccccacccttcgcccagcaccttgcggccgcagctcccgccg
gagacggtcaccacggtggcaccgccgggcaccgggcctactaccgtgccgacgcgaacc
cccaccgccgcgccacctcagactgctgtgccaccgccggcgccgctgaatccgcgcacc
gtcgtctaccgcgtgaccggcaccaagcagctgttcgacctggtgaacgtcgtctacacc
gatgcgcggggcttcccggtgaccgacttcaacgtgtcgctgccgtggacgaagatggtc
gttctgaaccccggcgtgcaaaccgaatcggtcgtcgcgaccagcctttacagtcgtctc
aactgctcgatcgtcaataccggcgctcagacggtggtggcgtcaaccaacaatgcgatc
atcgcgacatgcactcgctag

DBGET integrated database retrieval system